KEGG   Gallus gallus (chicken): 396284
Entry
396284            CDS       T01006                                 

Gene name
MYL12A
Definition
(RefSeq) myosin regulatory light chain 2, smooth muscle minor isoform
  KO
K12757  myosin regulatory light chain 12
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
gga04530  Tight junction
gga04810  Regulation of actin cytoskeleton
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396284 (MYL12A)
   04530 Tight junction
    396284 (MYL12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396284 (MYL12A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396284 (MYL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    396284 (MYL12A)
   04147 Exosome [BR:gga04147]
    396284 (MYL12A)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     396284 (MYL12A)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   396284 (MYL12A)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 EF-hand_9 SPARC_Ca_bdg DUF3741 DUF2666
Other DBs
NCBI-GeneID: 396284
NCBI-ProteinID: NP_990672
CGNC: 49735
Ensembl: ENSGALG00000014854
UniProt: P24032
Position
2
AA seq 172 aa
MSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGFIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtctagcaaaagggcaaagacgaagaccaccaagaagcgccctcagcgcgccacgtcc
aatgtatttgccatgtttgatcagtcccagatccaggaattcaaggaggccttcaacatg
attgatcagaacagggatggcttcattgacaaggaggacttgcacgacatgcttgcctcc
ctcgggaagaacccaacggatgaatacctggatgccatgatgaacgaggctccagggccc
atcaacttcacaatgttcctcacaatgtttggtgagaagctcaatggcactgatccggaa
gatgtcatcaggaatgcttttgcttgctttgacgaagaagcaacagggtttattcaagaa
gactacctgcgggagctgctgaccacgatgggagacaggttcacagatgaagaggtagat
gagctctacagagaggcaccaatcgacaaaaagggcaatttcaactacattgaattcacg
cgcatccttaaacatggagcaaaagacaaggatgactga

DBGET integrated database retrieval system