KEGG   Gallus gallus (chicken): 396301
Entry
396301            CDS       T01006                                 

Gene name
HOXD8
Definition
(RefSeq) homeobox protein Hox-D8
  KO
K09308  homeobox protein HoxB/C/D8
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396301 (HOXD8)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    396301 (HOXD8)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 396301
NCBI-ProteinID: NP_997060
CGNC: 49743
Ensembl: ENSGALG00000037272
UniProt: P23459
Position
7
AA seq 188 aa
MSSYFVNPLYSKYKAAAAAAAAVAAGEPLPAPYYDCHFAPERQQIFTTQQEAELVQYPDC
KSSSANIGEEPDHLNQSSSPAQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYL
TRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPASKQEGKEGEAKKETHDLED
DRAESHTN
NT seq 567 nt   +upstreamnt  +downstreamnt
atgagctcctactttgtcaacccgctctactccaagtacaaggcggcggctgcggctgcg
gcggcggtggcggcgggggagcctctgcccgccccgtactacgactgtcacttcgcgccc
gagagacagcagatttttacgacacagcaagaggccgagctggtacaatatcctgactgt
aaatcgtccagtgctaatattggcgaggaaccagaccacttaaatcagagctcgtctccc
gctcaaatgtttccctggatgagaccgcaagcagcgcccgggaggaggagagggcggcag
acgtacagccgcttccagacgctggagctggagaaggagtttctctttaacccctatctg
accaggaagagacgaatcgaggtgtcccacgccctaggactcaccgagcggcaggtaaag
atctggtttcagaacaggaggatgaagtggaaaaaggagaacaacaaggacaaattcccc
gcttccaagcaggagggaaaggaaggggaggccaaaaaggaaacacatgatctggaagac
gacagagccgaaagccacacgaattaa

DBGET integrated database retrieval system