KEGG   Gallus gallus (chicken): 396308Help
Entry
396308            CDS       T01006                                 

Gene name
BMPR1A
Definition
(RefSeq) bone morphogenetic protein receptor type-1A precursor
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    396308 (BMPR1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    396308 (BMPR1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396308 (BMPR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    396308 (BMPR1A)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     396308 (BMPR1A)
Protein kinases [BR:gga01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   396308 (BMPR1A)
CD molecules [BR:gga04090]
 Proteins
  396308 (BMPR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 396308
NCBI-ProteinID: NP_990688
CGNC: 1421
Ensembl: ENSGALG00000002003
UniProt: Q90754
Position
6
AA seq 533 aa AA seqDB search
MTRLRVCERLLGAYLLIILHVQGQNLDSMLHGTGMKTNPDQKKQGNGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDEHGEPTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTDFCNQDLQPTLPPLDSTDGLFDGSIRWMAVLISMAVCIIVMIILFSCFCYKHY
CKSMAKRHCYNRDLEQDEAFIPAGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQ
VGKGRYGEVWMGKWRGEKVAVKLFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGT
GSWTQLYLITDYHENGSLYDFLKCTTLDNRALLKLAYSAACGLCHLHTEIYGTQGKPAIA
HRDLKSKNILIKKNGTCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNK
NHFQPYIMADIYSFGLIIWEMARRCVTGGIVEEYQLPYYDMVPNDPSYEDMREVVCVKRL
RPVVSNRWNSDECLRAILKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcgactgagagtttgtgagcgattgcttggagcctatctgcttatcattctccat
gttcaaggacaaaatctagacagcatgctccatggcacaggaatgaagacaaatcctgac
caaaagaaacaaggaaatggggtaacgctcgctccagaggacaccttaccattccttaag
tgctactgctcaggacattgtccagatgatgctattaataacacatgcataactaatggg
cattgctttgctatcattgaggaagatgaacatggggaaccaacacttgcttctggctgc
atgaagtatgaaggttcagacttccagtgcaaggattcaccaaaagcacaattacgtcgg
acaattgagtgctgtcggactgatttctgcaatcaggatttacagccgacattaccaccg
cttgatagtacagatggactttttgatggcagcattcgttggatggcagtcttaatttct
atggcagtctgcataattgttatgatcatcttatttagctgcttttgttacaagcattat
tgtaagtcaatggcaaagagacactgttataatcgtgacctggaacaagatgaagcattc
attccagctggggagtcgttaaaagacctcattgaccagtcgcaaagttctggcagtggc
tcagggctaccattgctggttcagcgcacgattgccaaacaaattcagatggtgaggcaa
gttggaaagggacgatatggtgaagtgtggatgggcaaatggagaggtgaaaaagttgca
gtcaaattgtttttcaccacagaagaagccagctggttccgagaaacagagatttaccaa
actgttttaatgcgtcatgaaaacatccttggttttatagctgcagatattaaaggcact
ggatcctggacacagctttacttgattacagattatcatgaaaatggatcactatatgat
tttctgaagtgcactacactagacaacagggctctcctcaaactggcatactctgctgca
tgtggtctgtgccatttacacacagaaatctatgggacgcaaggcaagcctgctatagca
cacagggacctgaaaagtaaaaacattttgataaagaagaatgggacatgctgtattgct
gacttgggtctcgcagtcaagtttaacagtgatacaaatgaagttgatgttcccttgaat
actagagtgggaacaaaacgttacatggctccagaggtccttgatgaaagcctgaataaa
aaccattttcaaccatacatcatggctgacatatacagttttgggctgataatttgggaa
atggctcgacgctgtgtcacaggaggtattgttgaagagtaccagttgccatactatgac
atggtgccaaatgatccatcttatgaggacatgagagaagtggtgtgtgtcaaacgtctg
cgcccagtagtatctaacagatggaatagtgatgaatgtttaagagcaatattaaaatta
atgtctgaatgctgggctcacaatcctgcttcaagactcactgccttgaggatcaagaag
acgcttgccaagatggtggaatcacaagatgtaaagatttga

DBGET integrated database retrieval system