KEGG   Gallus gallus (chicken): 396313
Entry
396313            CDS       T01006                                 

Gene name
FGF8
Definition
(RefSeq) fibroblast growth factor 8 precursor
  KO
K04358  fibroblast growth factor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396313 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396313 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    396313 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    396313 (FGF8)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   396313 (FGF8)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   396313 (FGF8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 396313
NCBI-ProteinID: NP_001012785
CGNC: 49748
Ensembl: ENSGALG00000007706
UniProt: Q90722
Position
6
AA seq 214 aa
MDPCSSLFSYVFMHLFVLCLQAQVTVQSPPNFTQHVREQSLVTDQLSRRLVRTYQLYSRT
SGKHVQILDNKKINAMAEDGDVHAKLIVETDTFGSRVRIKGAATGFYICMNKKGKLIGKS
NGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPK
GHQTTEPHRRFEFLNYPFNRRSKRTRNSSASLRP
NT seq 645 nt   +upstreamnt  +downstreamnt
atggacccctgctcctcgctcttcagctacgtgttcatgcacttgttcgtcctctgcctg
caagcccaggtaactgttcagtccccacctaattttacacagcatgtgagggagcagagc
ctggtgacagatcagctcagccggcggctcgtgcgcacctaccagctgtacagccggacc
agcgggaagcacgtgcagatcttggacaacaagaaaatcaatgcgatggccgaggacggg
gatgtgcacgccaagctcatcgtcgagaccgacacctttgggagccgcgtgcgcatcaaa
ggggcggccacggggttctacatctgcatgaacaagaaggggaaactgatcggcaagagt
aacggcaaaggcaaggactgcgtcttcactgagatcgtgctggagaacaactacacggcg
ctgcagaacgccaagtacgagggctggtacatggccttcacccgcaagggccgcccgcgc
aagggctccaagacccggcagcaccaacgcgaggtgcacttcatgaagcggctccccaag
ggccaccagaccaccgagccccaccggcgcttcgagttcctcaactaccccttcaaccgc
aggagcaaaaggactcgaaactccagcgcctccctgcgcccatga

DBGET integrated database retrieval system