KEGG   Gallus gallus (chicken): 396319
Entry
396319            CDS       T01006                                 

Gene name
MTNR1A
Definition
(RefSeq) melatonin receptor type 1A
  KO
K04285  melatonin receptor type 1A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396319 (MTNR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    396319 (MTNR1A)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Others
   Melatonin
    396319 (MTNR1A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4 TctB
Other DBs
NCBI-GeneID: 396319
NCBI-ProteinID: NP_990693
CGNC: 49752
Ensembl: ENSGALG00000013576
UniProt: P49285
Position
4
AA seq 353 aa
MRANGSELNGTVLPRDPPAEGSPRRPPWVTSTLATILIFTIVVDLLGNLLVILSVYRNKK
LRNAGNIFVVSLAIADLVVAIYPYPLVLTSVFHNGWNLGYLHCQISGFLMGLSVIGSIFN
ITGIAINRYCYICHSLKYDKLYSDKNSLCYVGLIWVLTVVAIVPNLFVGSLQYDPRIYSC
TFAQSVSSAYTIAVVFFHFILPIAIVTYCYLRIWILVIQVRRRVKPDNNPRLKPHDFRNF
VTMFVVFVLFAVCWAPLNFIGLAVAVDPETIIPRIPEWLFVSSYYMAYFNSCLNAIIYGL
LNQNFRREYKKIVVSFCTAKAFFQDSSNDAADRIRSKPSPLITNNNQVKVDSV
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgcgagcgaacggcagcgagctgaacggcaccgttctcccgcgggacccgccggccgag
ggctccccgcgccgcccgccctgggtcacctccacgctagccaccatcctcatcttcacc
atcgtggtggacctgctgggcaacctcctggtcatcctctcggtgtaccgcaacaagaaa
ctgcggaacgcgggaaatatatttgtggtaagcctggcaattgcagacttggtcgtagca
atctatccatatccactggtcctgacatctgtatttcacaatggatggaatctgggatat
cttcactgtcagattagtggattcttgatgggcctaagtgtcattggatcaattttcaat
attactggcattgctatcaatcgatactgctatatctgccacagtctcaaatatgacaag
ctgtacagtgacaagaattctttgtgttatgttggtcttatctgggtcctaacagttgtt
gctattgtgcccaacctgtttgtgggatctctacagtatgaccccaggatttattcgtgc
acatttgcacagtctgtgagttccgcatatacaatagcagtggtgtttttccacttcata
cttcccatagccatagttacttattgttacttgagaatatggatccttgttattcaggta
agacgaagagttaaaccagacaacaacccccgattgaaaccacatgacttcagaaacttt
gtaaccatgtttgtggtatttgtactgtttgcagtctgttgggctccattgaacttcatt
ggccttgctgtggctgttgacccagaaactataatccctagaattccagagtggttgttc
gtgtctagctattacatggcatatttcaacagctgccttaatgccattatatatggactc
ctgaatcagaacttcagaagagaatacaagaaaattgttgtcagtttttgtacagcaaaa
gcttttttccaggacagttctaatgatgcagcagacaggataagaagtaaaccttctcca
ctgattacaaacaacaatcaagtgaaggtggactctgtgtga

DBGET integrated database retrieval system