KEGG   Gallus gallus (chicken): 396324
Entry
396324            CDS       T01006                                 

Gene name
ACVR2A
Definition
(RefSeq) activin receptor type-2A precursor
  KO
K04670  activin receptor type-2A [EC:2.7.11.30]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    396324 (ACVR2A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    396324 (ACVR2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396324 (ACVR2A)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     396324 (ACVR2A)
Protein kinases [BR:gga01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   396324 (ACVR2A)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal APH Dynein_IC2
Other DBs
NCBI-GeneID: 396324
NCBI-ProteinID: NP_990698
CGNC: 9451
Ensembl: ENSGALG00000012444
UniProt: Q90669
Position
7
AA seq 513 aa
MGAATKLAFAVFLISCSSGAILGRSETQECIYYNANWEKDKTNRSGIEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRNDCIEKKDSPEVFFCCCEGNMCNERFFYFPEM
EVTQPTSNPVTPKPPLFNTLLYSLVPIMGIAVIVLFSFWMYRHHKLAYPPVLVPTQDPGP
PPPSPLMGLKPLQLLEIKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEIYSLPG
MKHDNILQFIGAEKRGTSIDVDLWLITAFHEKGSLTDFLKANVVSWNELCHIAQTMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTASDGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRECWQKHSGMAMLCETIEECWDHDAEARLSAGCVEERII
QMQKLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgggagctgctacgaagttagcgttcgctgtttttctcatctcgtgttcttcaggtgcc
attcttggcagatcagaaacacaagaatgcatctactacaacgctaattgggagaaagat
aaaacaaatcgcagtggcattgaaccctgttatggagataaagataaaagacgacactgt
tttgctacatggaagaatatttctggatcaattgaaatcgtgaaacaaggttgctggctg
gatgacatcaactgttacgacaggaatgattgcattgagaaaaaagacagccctgaagtg
ttcttctgttgttgtgaaggcaacatgtgtaatgaacgcttcttctattttccagaaatg
gaggtcacacagccaacttccaatccagtcacaccgaagccacctctattcaataccttg
ctttattcattggtgcctataatgggaattgcagtgattgtgctcttttcattttggatg
tacagacatcacaagctagcatatcctccagtacttgttccaacccaagatcctggacca
ccaccgccttcaccattgatgggtttgaagccactgcagttgctagagatcaaagccagg
ggacgatttgggtgtgtgtggaaagctcagctgctgaatgagtatgttgcagtcaaaata
ttccctatccaggacaaacagtcgtggcagaatgaatatgaaatttacagcctacctgga
atgaagcatgacaatattttacagttcatcggtgcagagaagcgaggcaccagcattgat
gtggacctctggttaattacagcttttcacgaaaagggttcattaactgacttcctcaag
gctaacgtggtttcctggaatgagctgtgtcacattgctcagactatggctcgaggcttg
gcttatctccatgaggatataccagggctaaaagacggacataaacccgccatctcacac
agggacatcaaaagcaagaatgtgctgctgaaaaacaaccttacagcttgcattgctgat
tttggtctagctttaaagtttgaggctggaaaatctgcaggagatacacatggacaggtt
ggcacacgaaggtacatggctcctgaggtactagaaggtgctataaacttccaaagggat
gcgtttttgagaatagacatgtatgccatgggcttggtcctctgggagctggcatcgcgc
tgcactgcctcagatggcccagtagatgagtacatgttgccatttgaagaagaaattggc
cagcatccttcccttgaagacatgcaggaagttgtggttcataaaaagaagagacctgtt
ttaagagagtgttggcaaaagcattctggaatggcgatgctctgtgaaaccatcgaggag
tgctgggatcacgacgcagaagccaggctgtcggcggggtgcgtagaagaacgcattatt
cagatgcaaaaattaactaacattataacaacagaggacattgtgactgtggtcacgatg
gtgacaaacgttgactttcctcccaaagaatccagtctatga

DBGET integrated database retrieval system