KEGG   Gallus gallus (chicken): 396338Help
Entry
396338            CDS       T01006                                 

Gene name
MTNR1B
Definition
(RefSeq) melatonin receptor type 1B
  KO
K04286  melatonin receptor type 1B
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396338 (MTNR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    396338 (MTNR1B)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Others
   Melatonin
    396338 (MTNR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4 Git3
Motif
Other DBs
NCBI-GeneID: 396338
NCBI-ProteinID: NP_001280032
CGNC: 12946
Ensembl: ENSGALG00000017228
UniProt: P51050 A0A0A0MQ60
Position
1
AA seq 361 aa AA seqDB search
MLENGSLRNCCEPGGRGHFGSAEREAAAGGAPRPAWVVTALSSVLIFTTVVDILGNLLVI
VSVFKNRKLRNSGNAFVVSLALADLVVALYPYPLVLLAIFHNGWTLGEMHCKVSGFVMGL
SVIGSIFNITAIAINRYCYICHSFAYDKVYSCWNTMLYVSLIWVLTVIATVPNFFVGSLK
YDPRIYSCTFVQTASSYYTIAVVVIHFIVPITVVSFCYLRIWVLVLQVRRRVKSETKPRL
KPSDFRNFLTMFVVFVIFAFCWAPLNFIGLAVAINPSEMAPKVPEWLFIISYFMAYFNSC
LNAIIYGLLNQNFRNEYKRILMSLWMPRLFFQDTSKGGTDGQKSKPSPALNNNDQMKTDT
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaatggatctctgaggaactgctgcgagccgggcgggaggggtcacttcggc
tcggcggagcgggaggcggcggctggaggcgccccgcggcccgcctgggtggtgacggct
ctctccagcgtgctgatcttcaccaccgtggtggacattttgggcaacctgctggtcatc
gtgtccgtcttcaagaaccgcaagctcaggaactcaggtaatgcatttgtggtgagcctg
gctttggctgatctggtggtggccttgtatccatacccactggtgctcttagctattttc
cacaatggatggactttgggtgaaatgcactgtaaagtgagtggctttgtgatgggacta
agtgtaataggctctattttcaacatcactgcaattgcaataaaccgatattgctatata
tgtcatagctttgcctatgacaaagtgtatagctgttggaacacaatgctctatgtgtcc
ttaatctgggtattaacagtaattgcaactgtgccaaatttttttgtcggctctctgaag
tatgatccacgcatctattcatgcacatttgttcagactgcaagctcctactatacaatt
gcagttgtggtaattcatttcatcgtccctattactgttgtgagcttctgctatcttcga
atttgggtcttagtgcttcaagttagaagacgagtcaagtcagaaacaaagccaagactg
aaaccaagtgacttcagaaactttcttaccatgtttgtggtttttgtgatttttgccttt
tgctgggcacctctaaacttcataggactggctgtagccatcaatccttcagaaatggca
ccaaaagttcctgaatggttattcattataagctacttcatggcctatttcaacagctgc
cttaatgcaataatatatggacttcttaaccagaattttcggaatgaatacaaacgtatt
ttaatgtcactgtggatgccaaggcttttcttccaggacacatccaaaggaggaactgat
ggacagaagagcaagccttctcctgctttaaacaacaatgaccaaatgaaaactgacacc
ttgtaa

DBGET integrated database retrieval system