KEGG   Gallus gallus (chicken): 396346
Entry
396346            CDS       T01006                                 

Gene name
SOHO-1
Definition
(RefSeq) sensory organ homeobox protein SOHo
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 396346
NCBI-ProteinID: NP_990717
CGNC: 49762
Ensembl: ENSGALG00000015599
UniProt: Q91964
Position
4
AA seq 259 aa
MVQLGGGRGAPPPLLAPPSAFSIDSILQPGPRCQAREQGRARCALPEDEEEEEEEEEGPA
EEHPTKGSTDSGSERLLAEGPRRADAEAEGAVSPLSTERFRGCRQPSLRDTGGCGRESGR
CSAAGGKKKTRTIFSKSQVFQLESTFDVKRYLSSAERAGLAAALHLTETQVKIWFQNRRN
KLKRQLSAEPEGPGQAEPPGEPPPPPAASFSFPSLYKDSALFSRCLLPLPFPLFYPGSAI
PYLCLPGPVKHFSLLDGDV
NT seq 780 nt   +upstreamnt  +downstreamnt
atggtgcagctcgggggaggccgcggagccccaccgcctctcctggccccaccgtcggcc
ttcagcatcgacagcatcctgcagcccggtccccgctgccaggcccgggagcaggggagg
gcccgctgcgcgctgccggaggacgaggaggaggaggaggaggaagaagaggggcctgcg
gaggaacaccccactaaaggctccaccgactcgggcagcgagaggctgctggcggaaggg
ccgcgccgcgcggatgccgaggccgaaggcgcggtttcaccgctctccacggagaggttc
cgcggatgccgacagccgtcgctgcgggataccgggggctgcggtagagagagcggcagg
tgttcagcggcgggaggcaagaagaagacgcggaccatcttctccaagagccaggtcttc
cagctggagtccaccttcgacgtgaagcgctacctgagcagcgccgagcgggccggtctg
gccgccgcgctgcacctcaccgagacgcaggtgaagatctggttccagaaccgccgcaac
aagctcaagagacagctgtcggctgaacccgagggtccgggccaagcggaacccccaggg
gagcctcctccgcctcccgccgcctctttctccttcccgtccctatacaaggacagcgcc
ctgttcagccgctgcctgctgccactcccctttcctctgttctacccgggcagcgccatc
ccctacctctgccttcccggtccggtcaagcacttcagcctgctggacggggacgtatag

DBGET integrated database retrieval system