KEGG   Gallus gallus (chicken): 396364
Entry
396364            CDS       T01006                                 

Gene name
CHRM1
Definition
(RefSeq) muscarinic acetylcholine receptor M3
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    396364 (CHRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396364 (CHRM1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396364 (CHRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    396364 (CHRM1)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    396364 (CHRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 396364
NCBI-ProteinID: NP_990730
CGNC: 49770
Ensembl: ENSGALG00000010778
UniProt: P49578
Position
3
AA seq 639 aa
MLTHYQLCFQKRSSQNYTVPDPTSCFDVPPWTILCQRATMIMHNNSSALPLFSNVSSFWK
RDSHGPGLLDEGASLIGSYDSPETTESFPFSTVETTNSSLNATIKDPLGGHAVWQVVLIA
FLTGIIALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMG
HWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLA
WIISFVLWAPAILFWQYFVGKRTVPLDECFIQFLSEPIITFGTAIAAFYLPVTIMSILYW
RIYKETEKRTKELAGLQASGSEAETARFVHQTGSSRSLSSYELQRQSTKRSSRRKYRRCH
FWLTMKSWEPNTDQGDQEHSSSDSWNNNDAAASLENSASSDEEDITAETRAIYSIVLKLP
GHSAILNSTKLPSSEDLNESADELQKSDTDSQEKKPKKLQPPKSIQDGGSFQKSFSKLPI
QPGSAETATASDGISSVTKTSAALPLSFKEATLAKKFALKTRSQITKRKRMSLIKEKKAA
QTLSAILFAFIITWTPYNIMVLVNTFCDCVPKTVWNLGYWLCYINSTVNPVCYALCNKMF
RNTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRIPREAS
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgctgacacactaccagttgtgtttccaaaagaggagttcacagaactacacagtgcct
gatcctactagctgctttgatgttcctccctggaccatactatgtcagagagccacaatg
atcatgcacaataacagttcagccttgcccctgttttcaaatgtgagctcattctggaag
agggattcccatggaccaggactacttgatgaaggagcatcacttattggcagctatgat
tcccctgagaccacagagagctttcctttctccactgtggaaacaacaaactcatcccta
aatgccacaattaaagaccctctgggtggacacgctgtctggcaagtagttttgattgct
ttcctcactgggatcattgcactggtgaccatcataggaaacatcctcgtgattgtctca
tttaaggttaacaaacaactgaaaacagtcaacaactacttcttgttgagtcttgcttgt
gcagatttgatcatcggtgttatttccatgaatcttttcaccacatacatcattatgggc
cactgggctttgggaaacttggcctgtgatctttggctctccattgactatgttgccagt
aatgcctctgtcatgaatcttcttgtcataagttttgacaggtatttttccattactagg
ccacttacatacagagccaaacgaacaaccaaaagggctggagtgatgattggtttagca
tggattatctcttttgttctttgggcccctgccatcttattctggcagtattttgttggg
aagaggactgtgcctcttgatgaatgttttatccagtttctaagtgaacctatcatcact
tttggcactgccatagctgccttttacttgccagtcaccattatgagtattttgtattgg
aggatttacaaggagactgagaaacgcaccaaagagttagcaggactacaggcttcaggc
agcgaggcagagacagcacgctttgtacaccagacaggcagctcccggagcctgagcagc
tatgaactgcaacggcagagcacgaagcgctccagccgtaggaagtacaggcgctgccac
ttctggctcacaatgaagagctgggaacccaacacagaccagggggatcaagagcacagc
agcagtgacagctggaacaacaatgacgctgctgcctcccttgaaaattcagcctcatct
gatgaagaagacatcacagcggagaccagagctatctattcaatcgtgctgaagcttcct
ggtcacagtgccatcctcaattccacaaagttgccctcctcggaagatctgaatgagtca
gcagatgaactgcagaaatctgacacggactcacaggaaaagaaacctaaaaaactgcaa
cctcccaaaagcattcaggatggtggaagtttccagaagagtttttcaaagcttccaatt
cagccagggtcagcagagacagctacagcttctgatggcatctcatcagtgaccaagaca
tctgctgccctgcctttgtccttcaaggaagcaactctggcaaaaaaatttgccttgaag
accagaagtcaaatcacaaagcgaaaacgaatgtcacttatcaaagaaaagaaagcggca
cagacactcagtgccattttgtttgcctttatcattacctggactccatataacatcatg
gttctggtgaacaccttttgcgactgtgtccccaaaactgtctggaacctggggtactgg
ctttgctacatcaacagcacggtgaaccctgtgtgctatgcactgtgtaacaaaatgttc
agaaatactttcaagatgttactgctgtgccagtgtgacaaacgaaaacgacgcaaacag
cagtatcagcaaaggcagtctgtcatttttcataagcggatccctagggaggcttcatag

DBGET integrated database retrieval system