KEGG   Gallus gallus (chicken): 396381Help
Entry
396381            CDS       T01006                                 

Gene name
LHX1
Definition
(RefSeq) LIM/homeobox protein Lhx1
  KO
K09372  LIM homeobox protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396381 (LHX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    396381 (LHX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 396381
NCBI-ProteinID: NP_990744
CGNC: 4028
Ensembl: ENSGALG00000005409
UniProt: P53411
Position
19
AA seq 406 aa AA seqDB search
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLN
NSNTAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKETGSNENDDQNLGAKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLVDRLEPGELLPNGPFSFYGDYQSEYYGPGANYEFFPQGP
PSSQAQTPVELPFGAAGGPPGTPLGALEHPLPGHHPPGEAQRFPDMLAHPAGDSPSPEPT
LPGSLHSMSAEVFGPSPPFSSISVNGGANYGNHLSHPPEMNEAAVW
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggttcactgtgcgggctgcaaaaggccaatattggaccggttcttgttgaatgtactg
gacagggcttggcatgtgaagtgtgttcagtgctgtgaatgtaaatgcaatttgacagag
aaatgcttttcgcgagaaggcaagctttactgcaaaaacgacttctttcggtgtttcggg
accaagtgtgcgggctgtgcccagggcatctcccccagcgacctggtccgcagggcgcgg
agcaaagtgttccacttgaactgttttacgtgtatgatgtgcaacaagcagctctccacc
ggcgaggagctctatatcatagacgaaaacaagttcgtctgcaaagaagattacctaaat
aacagcaatactgccaaagaaaacagcctgcattcagctaccaccggcagtgaccccagc
ctgtcccccgactcccaagacccctcccaggacgacgccaaggactcggaaagcgccaac
gtgtccgacaaggagacgggcagcaacgagaacgacgaccagaacctgggggccaagcgg
cgggggccccgcaccaccatcaaagccaaacagctagagactctgaaggccgccttcgcg
gccacccccaaacccacgcggcacatcagggagcagctggcgcaggagaccggcctcaac
atgcgcgtcatccaggtgtggttccagaaccgccgctccaaggagcgccgcatgaagcag
ctgagcgcgctgggcgcccgccggcacgccttcttccgcagcccgcgcaggatgcggccg
ctggtggaccgcctggagcccggcgagctgctccccaacgggcccttctccttctacgga
gattaccagagcgagtactacggccccggggcgaactacgagttcttcccgcaaggcccg
ccctcctcgcaggcgcagacgccggtggagctgccgttcggggcggcgggcggaccgccg
ggcacgccgctgggcgcgttggagcacccgctgcccgggcaccacccgcccggagaggcg
cagcgcttccccgacatgctggcgcaccccgccggggactcgcccagccccgagcccacc
ctgcccggctccctgcactccatgtccgcggaagtgttcggccccagtcctccgttctcc
tcgatatccgtcaacggcggtgctaactacggcaatcacttgtcacacccaccagaaatg
aacgaagcggctgtgtggtag

DBGET integrated database retrieval system