KEGG   Gallus gallus (chicken): 396383
Entry
396383            CDS       T01006                                 

Gene name
ISL1
Definition
(RefSeq) insulin gene enhancer protein ISL-1
  KO
K09370  insulin gene enhancer protein ISL-1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396383 (ISL1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    396383 (ISL1)
SSDB
Motif
Pfam: LIM Homeodomain Homeobox_KN MerR_1
Other DBs
NCBI-GeneID: 396383
NCBI-ProteinID: NP_990745
CGNC: 11048
Ensembl: ENSGALG00000014884
UniProt: P50211
Position
Z
AA seq 349 aa
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDETCTCFV
RDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARAKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEK
TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS
IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
SDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgggagacatgggagacccaccaaaaaaaaaacgcctgatttccctatgtgttggttgc
ggcaatcaaattcacgatcagtatattctgagggtttctccggatttggaatggcatgcg
gcgtgtttgaagtgtgcagagtgtaatcagtatttggacgagacctgtacgtgctttgtt
agagatggcaaaacctactgtaaaagagattatatcaggttatacggcatcaagtgcgcc
aagtgcagcatcggcttcagcaagaacgacttcgtgatgcgcgcccgcgccaaggtgtac
cacatcgagtgtttccgctgcgtggcctgcagccgccagctcatccccggcgatgaattc
gcgctgcgggaggacggcctcttctgccgggcggaccacgacgtggtggagcgggccagc
ctgggcgccggggatcccctcagccccttgcacccggcccgaccgttgcagatggcagca
gaacctatctctgccagacagccagctctgcggccccacgtccacaagcagcctgagaag
accacccgagtccgaactgtccttaatgaaaagcagcttcacaccttgaggacctgctac
gctgccaaccccagacccgacgccctcatgaaagagcaactggtagaaatgactggcctc
agtccgagggtcatcagggtttggtttcaaaacaagcgatgcaaggacaaaaaaagaagc
attatgatgaagcaacttcagcagcagcaacccaatgacaaaactaatatccaagggatg
acaggaactccgatggtggctgctagtccggagagacatgatggtggtttacaggcgaac
ccggtggaggtgcaaagttaccagccaccctggaaagtactgagtgacttcgcattgcag
agtgacatagatcaacctgcttttcagcaactagttaatttttcagaaggaggacctggt
tccaattctaccggaagtgaagtggcatcaatgtcctctcagctcccagatacgcccaac
agcatggtagccagtcctattgaggcatga

DBGET integrated database retrieval system