KEGG   Gallus gallus (chicken): 396391
Entry
396391            CDS       T01006                                 

Gene name
GATA5
Definition
(RefSeq) transcription factor GATA-5
  KO
K17896  GATA-binding protein 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396391 (GATA5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    396391 (GATA5)
SSDB
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon ArfGap Zn_Tnp_IS1595
Other DBs
NCBI-GeneID: 396391
NCBI-ProteinID: NP_990752
CGNC: 3985
Ensembl: ENSGALG00000005352
UniProt: F1NZV5
Position
20
AA seq 391 aa
MYQGLALAPNHGQSAYSHDSGNFLHSSAGSPVYVPTTRVPSVLQTLPYLQSCEPHQSHLG
NPPGWAQSSGETTAFNAGSPHPPSGFSYPHSPPGSSPPGRDGAYQGPLLLGGGGREQYGN
ALVRSVNGSYSSPYPAYVTPELPPSWTAGHFESSVLHSLQTRQAALPGRRSTFEYLEEFP
GDGRECVNCGAMSTPLWRKDGTGHYLCNACGLYHKMNGINRPLKPQKRLSSSRRAGLCCT
NCHTTNTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKNITKGKTST
GSTTSATNSPSSITNSDSTVTLKSEPSTTSQYPGQGIVSVSQAQSQSDEALAGGEFKFEP
EDYPFSPSSMAPQPGLSVPLRQDSWCALALA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtatcagggcctggccctcgcccccaaccatggccagtcggcttattcccacgactcc
ggcaatttcctgcactcgtcggccggctcgcccgtctacgtgcccaccacccgggtgccc
tccgtgctgcagacgctgccctacctgcaaagctgcgagccgcaccagagccacctcggc
aaccccccgggctgggcgcagagcagcggcgaaaccaccgccttcaacgccggcagcccg
cacccgccgtcgggtttctcgtacccccacagccccccgggcagcagccccccggggcgt
gacggtgcctaccaggggcccctgctgctgggcggcgggggccgggagcagtacggcaac
gctttggtgcgctcggttaacgggtcctactccagcccctaccccgcctacgtgaccccc
gagctaccgccttcgtggacggccggacactttgagagcagcgtgctgcacagcctgcag
acgaggcaggcggccctgcccggccgcaggtcaaccttcgagtatttggaggagttcccc
ggggatggtcgggagtgcgtgaactgcggggccatgtccacaccgctctggaggaaggac
ggcaccgggcactacctgtgcaacgcctgtgggctctaccacaaaatgaacggcatcaac
cggccactcaaaccccagaagaggctgtcttcatcgagacgtgctggcctatgttgcact
aactgccacacaaccaacaccaccctctggagaaggaacgccgaaggggagcccgtctgc
aacgcctgcggcttgtacatgaagctccatggggtaccaagacctctggccatgaaaaag
gaaagcatccagacaaggaaaaggaagccgaaaaacattaccaaaggcaaaacctcaaca
gggtccaccacttcggccacgaactccccttcttccattacgaactcagacagcacggtc
actttaaagtcagagcccagcacaacctcacagtaccccggacaaggcattgtgtcggtg
tcccaggcacagagccagtcagacgaggcgctggccggcggcgagttcaaattcgagccg
gaggactaccccttttctcccagcagcatggccccgcagccagggctgagcgtgccactg
cggcaggactcgtggtgtgccctggcgctcgcctag

DBGET integrated database retrieval system