KEGG   Gallus gallus (chicken): 396392Help
Entry
396392            CDS       T01006                                 

Gene name
GATA4
Definition
(RefSeq) transcription factor GATA-4
  KO
K09183  GATA-binding protein 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04218  Cellular senescence
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    396392 (GATA4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    396392 (GATA4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396392 (GATA4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    396392 (GATA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon ArfGap OrfB_Zn_ribbon Prim_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 396392
NCBI-ProteinID: NP_001280035
CGNC: 12483
Ensembl: ENSGALG00000016662
UniProt: P43691 E1C9C6
Position
3
AA seq 410 aa AA seqDB search
MYQSLAMAANPGPPSYEGAGGFMHGAAAASPVYVPTTRVPSMLPSLPYLPSSGSSQQASP
VSSHSIWTQPGAESAAYNPGSSHPPVSPRFSFSTSTPIPSTSSRDAAAAYSSSLSLSANG
REQYSRGFGSSYSSPYPAYVSPEMATTWTSSPFDSPMLHNLQSRGTPAAARHANIEFFDD
YSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLFKPQRRLSASRRVGLS
CANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKTKT
PAGPSSSESLTPTTSSTSSSSSATTTEEMRPIKTEPGLSSHYGHPSPISQAFSVSAMSGH
GSSIHPAISALKLSPQAYQSAISQSPQASSKQDSWNSLVLAENHGDIITA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagagcttagccatggcggcgaaccccggccccccgtcctacgaaggggcaggt
ggcttcatgcacggcgccgctgccgcgtcccctgtgtacgtgcccaccaccagggtcccc
tccatgctccccagcctgccctacctgcccagtagcggctcctcccagcaagccagcccc
gtctccagccactccatctggactcaacctggagccgaaagcgccgcatacaaccccgga
tcttcccacccgcccgtgtcacctcgcttctccttctccaccagcactcccatcccctcc
acctcatcgcgggatgccgcggcggcttacagcagctccctgagcctttctgctaacggg
agggagcaatacagccggggcttcggcagctcctactccagcccttacccggcgtacgtg
agccctgaaatggccaccacttggacttcttcgcccttcgacagccccatgctgcacaac
ctgcagagcagagggacacccgcggccgcccggcatgccaacatcgaattttttgatgat
tattcagaagggcgagaatgtgtcaactgtggggccatgtccaccccgctctggaggaga
gatggcacagggcactacctctgcaatgcctgtgggctctatcacaagatgaacggcatc
aaccggcccttgttcaaacctcagcggaggctgtcggcttcccgtcgcgtcggcctctct
tgtgccaactgccacacgaccacaaccacactctggcgcagaaacgccgagggagagccc
gtctgtaatgcctgtggactctacatgaagcttcatggggttccaaggccattagcaatg
agaaaagagggcattcagacaaggaagcgtaagccgaagaaccttaacaaaacaaagacg
ccagcaggtccatccagcagtgagagtcttaccccgaccacgagctccacgagtagcagc
agcagtgccacgaccactgaggaaatgcgccccatcaaaacagaaccagggctctcatct
cattatgggcaccccagcccaatttctcaggcattctcggtctctgccatgtctggacat
ggatcttcaattcatcctgcaatttcagccctgaagctttccccgcaggcttaccagtca
gccatcagccagtctccacaagccagctccaaacaggactcctggaacagcctggtctta
gctgaaaaccatggggacatcataacggcataa

DBGET integrated database retrieval system