KEGG   Gallus gallus (chicken): 396402Help
Entry
396402            CDS       T01006                                 

Gene name
EPHA3
Definition
(RefSeq) ephrin type-A receptor 3 precursor
  KO
K05104  Eph receptor A3 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396402 (EPHA3)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     396402 (EPHA3)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   396402 (EPHA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Pur_ac_phosph_N Ephrin_rec_like fn3_2 Interfer-bind DUF2369 DUF4998 TMEM154 Kdo Haspin_kinase SusE DUF1934 Rax2 Arylsulfotran_N
Motif
Other DBs
NCBI-GeneID: 396402
NCBI-ProteinID: NP_990761
CGNC: 11474
Ensembl: ENSGALG00000015403
UniProt: P29318
Position
1
AA seq 983 aa AA seqDB search
MDRRRLPLLLLCAALGSAGRLSARPGNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEH
YTPIRTYQESNVMDHSQNNWLRTNWIPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFN
LYYMESDDDHLAKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEVREVGPVSKKGFYL
AFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNHSKEEEPPK
MYCSTEGEWLVPIGKCLCNAGYEERGFACQACRPGFYKASAGNVKCAKCPPHSSTYEDAS
LNCRCEKNYFRSEKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDVTFNI
ICKKCGGSSKICEPCSDNVRFLPRQTGLTNTTVTVVDLLAHTNYTFEIDAVNGVSDLSTL
SRQFAAVSITTNQAAPSPITVIRKDRTSRNSVSLSWQEPEHPNGIILDYEVKYYEKQEQE
TSYTILRAKSTNVTISGLKPDTTYVFQIRARTAARYGTSSRKFEFETSPDSFSISSENSQ
VVMIAISAAVAIILLTVVVYVLIGRFCGYKKSKHGTDEKRLHFGNGHLKLPGLRTYVDPH
TYEDPNQAVHEFAKELDASNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKAGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDAWSYGIVLWEVMSYGERPYWEMSFQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPSSLKIITNAAARPSN
LLLDQSNIDISAFRTAGDWLNGFRTGQCKGIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIVSSIKTLETHTKNSPVPV
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccgccgcctgccgctgctgctgctctgcgctgccctcggctccgccgggcgt
ctgagcgcccgccccggcaacgaagttaatctgctggattcaaaaacaattcaaggggag
ctgggctggatctcctacccatcacatgggtgggaagagattagtggtgttgatgagcat
tatactccaatcagaacttaccaagagagcaatgttatggatcacagtcaaaacaattgg
ctgcgaacaaactggattccacgcaattcagcgcagaagatatatgtggagctcaagttt
accttgagggactgcaatagtatccctctagttctgggcacttgcaaagagactttcaat
ctgtattacatggaatccgatgatgaccatttggcaaagttcagagagcaccaatttacg
aagattgacaccattgcggctgatgagagcttcacccagatggatcttggggaccggatt
ctcaagctgaataccgaagtccgcgaggtgggacctgttagtaagaagggcttttacttg
gctttccaagatgtaggtgcatgtgttgccttagtctcggtgcgagtgtacttcaagaag
tgccctttcactgtcaagaacctcgccatgtttccagatacagttcctatggactcccag
tccctggtggaggtgcggggttcttgtgtcaatcattccaaggaggaagagccacccaag
atgtactgcagcacggaaggagaatggctagtgcccatagggaagtgcttgtgtaatgct
ggctatgaagagagaggctttgcgtgccaagcttgtcgacctgggttctataaagcttct
gctggcaatgtgaagtgtgccaaatgcccacctcacagctctacctatgaagatgcatct
ctgaactgcaggtgtgaaaagaattactttcgctctgagaaagaccctccatccatggct
tgcaccagaccaccatctgctccaagaaacgttatttctaacatcaatgagacatctgtt
attctggactggagctggcctcttgatacaggaggtcgaaaagatgtcactttcaacatc
atttgcaaaaaatgtggaggaagcagcaagatatgtgagccttgcagtgacaacgtacgg
ttcttaccccgtcagactggcctcaccaacaccacggtgacagtagtggaccttttggca
cataccaattacacttttgagattgatgcagtcaacggggtatctgacttgagtacactt
tcgagacaatttgctgctgtcagcatcacgactaatcaggctgcgccatcccccatcaca
gtgataaggaaagaccggacatccaggaacagcgtgtctctgtcttggcaggagcctgag
cacccaaatggaatcatcttggactacgaggtcaaatactacgaaaagcaggaacaagag
acaagctatactattctgagagccaaaagcactaacgttactatcagcggcctcaaacct
gataccacctacgtcttccaaattcgagcccgaactgcagctagatatgggacaagcagc
cgcaagtttgaatttgaaaccagtccagattcattctccatttccagtgaaaatagccag
gtcgttatgattgccatttcagctgcagttgccatcattctcctcacggttgttgtgtac
gtcttgattgggagattctgcggatacaagaagtctaaacatggtaccgatgagaaaaga
ctacattttgggaatggccacttaaaactcccaggcctgagaacttatgtagatccacat
acgtacgaagatcccaatcaagctgtacatgaatttgccaaggaactagatgcttctaat
atatcaattgataaagttgttggagcaggggaatttggagaagtgtgcagtgggcgcctg
aagctgccttctaaaaaggaaatttcagtggccatcaaaactctgaaagctggctacaca
gaaaaacagagaagggatttcctgggagaagcaagcatcatggggcagtttgaccacccc
aacatcatccgactggagggcgttgtgactaaaagtaaaccagttatgattgttactgaa
tacatggaaaacggttccttggacagcttcctacggaaacatgatgcccagttcacagtc
attcagctagtaggcatgcttcgtgggatcgcatctggcatgaaatatttgtcagatatg
ggttatgtccaccgagatctagctgctcgtaatatactcatcaatagtaacttggtgtgc
aaagtctcagattttggtctttctcgtgtattggaagatgacccagaagctgcttacaca
acaagggggggcaagattcccatccgatggacgtcaccagaagccattgcataccggaag
ttcacatcagccagtgatgcgtggagctatgggattgtcctctgggaggtgatgtcttat
ggagaaaggccgtactgggagatgtccttccaggacgtaattaaagccgttgatgaaggg
tatcgcttgccacctcctatggactgcccagctgccttgtatcagctgatgctggactgc
tggcagaaagacagaaacaacagacccaagtttgagcagattgtcagcatcctggataag
ctgatccgtaatcccagcagtctgaaaataatcaccaatgcggcagcaaggccatcaaat
cttctcctggaccaaagtaacattgacatttcagcgttccgcacggcaggtgattggctc
aatggttttcgaacaggacagtgcaaaggcattttcacgggtgtggagtacagctcctgt
gatacaatagccaagatttccactgatgacatgaagaaagttggtgttacagttgtgggg
cctcaaaagaagattgttagcagtatcaaaactctagaaactcatacgaagaacagccct
gttcctgtgtaa

DBGET integrated database retrieval system