KEGG   Gallus gallus (chicken): 396404
Entry
396404            CDS       T01006                                 

Gene name
DDR2
Definition
(RefSeq) discoidin domain-containing receptor 2 isoform X2
  KO
K05125  discoidin domain receptor family member 2 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396404 (DDR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    396404 (DDR2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     396404 (DDR2)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  DDR family
   396404 (DDR2)
CD molecules [BR:gga04090]
 Proteins
  396404 (DDR2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F5_F8_type_C PTP_tm Shisa
Other DBs
NCBI-GeneID: 396404
NCBI-ProteinID: XP_025009023
CGNC: 66227
Ensembl: ENSGALG00000039322
Position
8
AA seq 824 aa
MSGGHIPDEDISASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLRALH
FITLVGTQGRHAGGHGNEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIVLKDL
EPPLIARFVRFIPVTDHSMNVCLRVELYGCAWLDGLVSYSAPAGQQLVLPSGTVIYLNDS
VYDGAFGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESTAGGYVEITFEF
DRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSDANEWEPNAISSVLVLDDVNPSARFVT
VPLLHRMASAIKCQYYFADTWMMFSEITFQSDAAMYNNSAVPPEMPMAPTTYDPTLKMDD
SNTRILIGCLVAIIFILVAIIVIILWRQFWQKMLEKASRRMLDDEMTVSLSLPSESSMFN
HNRSSSSSEHESNSTYDRIFPLGPDYQEPSRLIRKLPEFTAGEEDTGCSGLVKPSPASGP
EGVPHYAEAEIVNLQGVTGGNTYSVPALTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFG
EVHLCEVEGMEKFADKEFTLEGLDASPNCPVLVAVKMLRADANKNARNDFLKEIKIMSRL
KDPNIIRLLAVCITDDPLCMITEYMENGDLNQFLSRHEAQSPPDAQVPTISYSDLRFMAT
QIASGMKYLSSLNFVHRDLATRNCLVGKRYTIKIADFGMSRNLYSGDYYRIQGRAVLPIR
WMSWESILLGKFTTASDVWAFGVTLWETFTLCREQPYSQLSDEQVIENTGEFFRDQGRQT
YLPKPALCPDSVYKLMLSCWRRDTKDRPSFQDLHRQLQEAATEE
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgtcgggtgggcacatccctgatgaggacatctcagcctccagccagtggtccgagtcc
acggccgccaagtacggacggctggactcggaggagggcgatggtgcctggtgccccgag
atcccagtagagcctgacgacctgaaggagttcctgcagattgacctgcgtgccctccac
ttcatcacactggtgggcacccagggccgtcacgccggagggcatggcaatgagtttgcc
cccatgtacaagatcaactacagccgggacggcacccgctggatctcctggcggaaccgg
cacgggaagcaggtcctggatggaaactccaacccctacgacatcgtcctcaaggacctg
gagccaccgctcattgcgcgcttcgtccgcttcatccccgtcaccgaccactccatgaac
gtgtgcctgcgtgtggagctgtacggctgcgcgtggcttgacgggctggtgtcctacagt
gctccggccgggcagcagctcgtcctacccagcggcaccgtcatctacctgaacgactct
gtgtatgatggggccttcgggtacagcatgacagagggcctgggccagctgacagatggc
gtgtcggggctggatgacttcacacagacccacgagtaccacgtctggccgggctatgac
tacgtgggctggcgcaatgagagcacagccggcggctacgtggagatcaccttcgagttt
gaccgcatcaggaacttcaccaccatgaaggtgcactgcaacaacatgttcgccaaaggg
gtgaagatcttcaaggaggtgcaatgctatttccgatccgatgccaacgagtgggagccc
aacgccatctcctcggtgctggtgctggacgacgtcaaccccagcgcccgcttcgtcacc
gtgcccctgctgcaccgcatggccagtgccatcaagtgccagtactactttgccgacacc
tggatgatgttcagcgagatcaccttccagtcggatgcagccatgtacaacaactcagca
gttcccccggagatgcccatggcccccaccacatacgaccccacgctcaagatggacgat
agcaacacacgcatcctgatcgggtgcctggtggcaatcatcttcatcctggtggccatc
atcgtcatcattctgtggcggcagttctggcagaagatgctggagaaggcatcacggagg
atgctggatgacgagatgaccgtcagcctctccctgcccagtgaatccagcatgttcaac
cacaatcgctcctcctcctccagcgagcacgagtccaattccacctacgaccgcatattt
cccttgggtccggactaccaggagccctcacgcctgatccgcaagctgcctgagttcacg
gcgggtgaggaggacacgggctgcagtggcctcgtgaagccatccccggccagcggcccc
gagggtgtcccgcactacgccgaggctgagattgtgaacctgcagggcgtcacgggtggc
aacacctactcggtgccggccctcaccatggacctgctgtctggcaaggacgtggctgtc
gaggagttccccaggaagctgctgaccttcaaggagaagctaggggagggccagtttggg
gaggttcatctctgtgaggtggaggggatggagaagttcgcggacaaggagttcaccctg
gagggcttggatgccagccccaactgccccgttctagtggctgtgaagatgctgcgggcc
gatgccaacaagaatgccaggaatgatttcctgaaggaaatcaagatcatgtcacggctc
aaggaccccaacatcatccggctgctggcggtgtgcatcacggacgacccgctgtgcatg
atcactgagtacatggagaacggcgacctcaaccagttcctgtcccgccacgaggcacag
agcccacctgatgcccaggtgcccaccatcagctacagcgacctgcgcttcatggccacc
cagatcgcctccggcatgaagtacctgtcctccctcaacttcgtgcaccgtgacctggcc
acacgcaactgcctggtgggcaagaggtacaccatcaagatcgccgacttcggcatgagc
cggaacctctacagcggggactactaccgcatccagggccgtgctgtgctgcccatccgc
tggatgtcctgggagagcatcctgctgggcaaattcaccacggccagcgatgtgtgggcg
tttggtgtgacactgtgggagaccttcacgctgtgccgggagcagccctactcacagctg
tctgacgagcaggtcatcgagaacaccggggagttcttccgggaccagggccggcagacg
taccttcccaagcctgcactgtgccccgactctgtctataagctaatgctgagctgctgg
agacgggacactaaagaccgtccctccttccaggacctgcaccgccagctgcaggaggcg
gccaccgaggagtga

DBGET integrated database retrieval system