KEGG   Gallus gallus (chicken): 396416Help
Entry
396416            CDS       T01006                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04370  VEGF signaling pathway
gga04510  Focal adhesion
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    396416 (PTK2)
   04370 VEGF signaling pathway
    396416 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396416 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396416 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396416 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    396416 (PTK2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     396416 (PTK2)
Protein kinases [BR:gga01001]
 Non-receptor tyrosine kinases
  FAK family
   396416 (PTK2)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     396416 (PTK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Focal_AT Pkinase FERM_N_2 FERM_M Haspin_kinase Kinase-like FERM_F2
Motif
Other DBs
NCBI-GeneID: 396416
NCBI-ProteinID: NP_990766
CGNC: 12089
Ensembl: ENSGALG00000031741
UniProt: Q00944
Structure
PDB: 

Position
2
AA seq 1053 aa AA seqDB search
MAAAYLDPNLNHTPSSSAKTHLGTGMERSPGAMERVLKVFHYFENSSEPTTWASIIRHGD
ATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSY
GEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFII
RPQKEGERALPSIPKLANNEKQGVRSHTVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSATDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKLQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQPNHYQVSGYSGSHGIPAMAGSIYPGQASLLDQTDSWNHRPQE
VSAWQPNMEDSGTLDVRGMGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLVMKPDVR
LSRGSIEREDGGLQGPAGNQHIYQPVGKPDHAAPPKKPPRPGAPHLGSLASLNSPVDSYN
EGVKIKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGL
ALRTLLATVDESLPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYKKQ
MLTAAHALAVDAKNLLDVIDQARLKMISQSRPH
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcttaccttgatccaaacttgaatcatacaccaagttcaagtgcaaagacg
cacctcggtactgggatggagcgttccccgggggccatggagcgagtcctaaaggttttt
cactactttgaaaacagcagcgagccaacgacgtgggccagcattatccggcatggagat
gctactgatgttcgaggcataatacagaagattgtggactgtcacaaagtgaaaaatgtg
gcctgctatgggttgcgactcagtcatctgcagtctgaggaggttcactggctgcacctg
gacatgggggtatccaatgtgagagagaaatttgaactagcacatcctccagaagaatgg
aaatatgaactgagaattcggtacctgcccaaaggatttctaaaccagttcactgaggac
aaaccaactttaaattttttctatcagcaggtgaaaaatgactatatgttagaaatagca
gatcaagtggaccaggaaattgctttgaaactaggttgccttgaaatcaggagatcctac
ggagagatgagaggcaatgcattagagaagaaatccaactatgaagtgctagaaaaagat
gtcggtttaagacgattttttccgaagagtttgctagattcagtgaaggccaaaacacta
cgaaaattaatccaacagacatttcgacaatttgccaacctcaacagagaagaaagtatt
ttgaaattctttgagatcctctctccagtgtacagatttgacaaggaatgcttcaagtgt
gcccttggttcaagctggattatttcagtggagctggcaattggcccagaggaaggaatc
agctaccttacagacaagggtgcaaatccaactcacctggcagattttaatcaagtacaa
actattcagtattcaaacagtgaagacaaggacagaaaagggatgttgcaactgaagata
gctggtgcacctgagcctctgacagtgacagcaccatccttaaccattgcagagaatatg
gctgacttgatagacggatactgccgactggtgaatggagccacgcaatcttttattatc
aggccacagaaagaaggtgaaagagctttaccatcaataccaaagctggccaacaatgag
aagcaaggagtaaggtcgcacacagtctctgtatcagaaacagatgactatgcagagata
atagatgaagaagatacttatacaatgccatcaaccagagattatgaaattcaaagggag
agaattgaactggggcgctgcattggtgaaggacagtttggagatgtgcaccaaggaatt
tacatgagtccggaaaatccagctatggctgtagcaatcaaaacatgtaaaaactgcacc
tcagacagcgttagagaaaagttcctacaagaagccttaacaatgcgtcagtttgatcat
cctcacattgtgaagctcattggagttattacagaaaacccagtgtggataatcatggag
ctctgtacacttggagagttgagatcgtttctgcaagtaagaaaattcagcttggacctg
gcctccctcatcctctacgcttaccagcttagcacagcacttgcttacctagagagcaaa
agatttgtacatagagatattgctgctaggaacgtgctggtatctgccactgactgtgtg
aaattgggtgactttggcttatcccgatacatggaagacagtacttactataaagcttcc
aaaggaaagttacctatcaaatggatggctccagagtcaatcaacttccgacggtttacc
tcagcaagcgatgtgtggatgtttggtgtgtgtatgtgggagatcctgatgcatggggta
aagcccttccagggagtgaaaaataatgatgttattggtcggattgagaacggtgagcgg
ctccccatgcctccgaactgccctcccaccctctacagccttatgaccaagtgctgggca
tacgaccctagtagacgacccaggtttactgaacttaaagcacaactcagtacaatactg
gaggaggagaagctgcagcaagaggaacgaatgagaatggaatccaggcgacaagtcaca
gtatcctgggactcaggaggatcagatgaagctcctcccaagcccagcaggcctggttac
cccagcccaaggtccagtgaagggttttatccgagtcctcagcatatggtacagccaaat
cactaccaggtatctggctactctggttctcatgggataccagccatggcaggcagcatt
tatcctgggcaagcttctctcttggatcaaacagattcctggaaccatcgacctcaggaa
gtatcagcatggcagccaaacatggaggattcgggcactttggatgtacgaggaatgggg
caggttctgcccacacatctcatggaggagaggttaataagacaacagcaagagatggaa
gaagatcaacgctggcttgagaaagaggaacgattcctggtaatgaaacctgatgtgcgg
ctctccagaggcagcattgaacgggaggacggaggtctccagggcccagctggtaaccag
cacatatatcagcctgtgggtaaaccagatcatgccgctccaccaaagaagccccctcgc
cctggagccccccacttgggcagcctcgcgagcctgaacagccccgtggacagctacaac
gaaggcgtgaagatcaagccacaggaaatcagccctcctcctacggccaacctggaccgc
tccaatgacaaagtctatgagaatgtaaccgggctggtgaaagctgtcatagagatgtcc
agtaaaatacagccagctccgccagaggagtacgtgcccatggtaaaggaggttggcttg
gcgctgagaaccttgctagcaacagtggatgagtcgctgccagtgcttcctgcaagcacc
cacagagagattgagatggcccagaaactgctgaactctgacctggctgagctcattaac
aagatgaagctggcccagcagtacgtcatgaccagcctgcagcaggagtacaagaagcaa
atgctgacggctgctcacgctctggctgtggatgccaagaacttgctggatgtcatcgat
caagccagactgaaaatgatcagccagtccaggccccactaa

DBGET integrated database retrieval system