KEGG   Gallus gallus (chicken): 396422
Entry
396422            CDS       T01006                                 

Gene name
VCL
Definition
(RefSeq) vinculin
  KO
K05700  vinculin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
gga04520  Adherens junction
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396422 (VCL)
   04520 Adherens junction
    396422 (VCL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396422 (VCL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    396422 (VCL)
   04147 Exosome [BR:gga04147]
    396422 (VCL)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     396422 (VCL)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396422 (VCL)
SSDB
Motif
Pfam: Vinculin VMAP-M0 CARD Flavodoxin_1
Other DBs
NCBI-GeneID: 396422
NCBI-ProteinID: NP_990772
CGNC: 3778
Ensembl: ENSGALG00000005079
UniProt: P12003
Structure
PDB: 

Position
6
AA seq 1066 aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALALIDSKMNQAKGWLRDPNAPPGDAGEQAIR
QILDEAGKAGELCAGKERREILGTCKTLGQMTDQLADLRARGQGATPMAMQKAQQVSQGL
DLLTAKVENAARKLEAMTNSKQAIAKKIDAAQNWLADPNGGSEGEEHIRGIMSEARKVAE
LCEEPKERDDILRSLGEISALTAKLSDLRRHGKGDSPEARALAKQIATSLQNLQSKTNRA
VANTRPVKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGRRLANVMMGPYRQD
LLAKCDRVDQLAAQLADLAARGEGESPQARAIAAQLQDSLKDLKARMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPSDTPNREEVFEERAANFENHAARLGATAEKAAAVGTANKTTVEG
IQATVKSARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANMQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEHLHLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEAINQPMMM
AARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGNKRALIQCAKDIAKASDE
VTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQAT
EMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3201 nt   +upstreamnt  +downstreamnt
atgcccgtcttccacacgcgcaccatcgagagcatcttggagcccgtggctcagcagatc
tcccacctggtcatcatgcacgaggagggggaggtagacggcaaggccatcccggacctc
accgcccccgtgtcggccgtgcaggccgctgtcagcaacctggtgcgggttggaaaagaa
actgtgcagacaacagaagaccagatcttgaaaagggatatgccaccagcattcatcaaa
gtagagaatgcctgcaccaagctcgttcgagcagcccagatgctgcaagcagatccttat
tcagtaccagctcgtgactacctaattgatggatcaagaggcatcctttctggaacatca
gacttgcttctgacatttgatgaagcagaggtccgtaaaatcatccgtgtctgcaaagga
atattggaatatctgactgtggcagaagtagtagagactatggaggatttggtgacatat
acaaagaatctagggccaggaatgacaaagatggcaaaaatgatcgatgagagacaacag
gaattaactcatcaggaacatagggttatgctggtgaactccatgaatactgtgaaggag
ctattgcctgtacttatttcagctatgaagatctttgtaaccacaaaaaacactaaaagc
cagggaatagaagaggccttgaaaaatcgcaatttcacagtagagaaaatgagtgctgag
ataaatgaaataatccgtgtattacaactcacttcctgggatgaagatgcctgggccagc
aaggacactgaagccatgaaaagagctttagccctaatagattcaaagatgaaccaggca
aaaggctggctgagagatccaaacgcacctccaggggatgctggtgagcaagcaataagg
cagatccttgatgaagctggaaaagcaggagaattgtgtgcaggcaaagaacgcagggag
attctgggaacatgcaaaactttgggccaaatgactgatcaacttgctgatctccgagct
agaggacagggtgctacaccgatggcaatgcagaaggcacagcaggtgtcacaaggcctg
gatttgctcactgcaaaagtggagaatgcagcccggaaattggaggccatgacaaactct
aagcaggctattgcaaagaagattgatgctgctcagaactggcttgcggatcccaacggc
ggaagtgaaggagaagaacacattcgaggaattatgtctgaagcaaggaaagttgcagaa
ttgtgtgaggagcctaaagaaagagatgatatccttcgctccttgggggaaatctctgct
ctgacagctaagctgtcagatctgcgacgacatgggaaaggcgactctcctgaggcccgt
gcattggccaagcaaatagctacatcacttcagaacttacagtccaaaacaaacagagct
gtagcaaatactaggccagttaaagctgctgtccatttggagggcaagattgagcaagcc
cagaggtggatagataatcctacagttgatgatcggggagtaggccaggcagcaattcgg
ggtttggttgcagaaggtcgtcgtctagccaatgtcatgatgggaccttatcgtcaggac
ctgcttgccaaatgtgaccgtgtagaccagctggctgctcagcttgctgaccttgcagca
agaggggaaggagagtctcctcaggctagggcaattgctgctcagcttcaggactccctg
aaggatctcaaagcacggatgcaagaagcaatgacccaggaggtgtctgatgtttttagt
gacactacaactcctattaagttgttagcagtagcagccactgctccttctgatactccc
aatagagaagaggtgtttgaagaaagagcagcaaattttgaaaaccatgctgctagactg
ggagcaacagcagaaaaagcagctgcagttggaactgctaataaaactactgtggaaggc
attcaggcaacagtcaaatctgcaagggagcttacaccacaggtagtatcggctgctcga
atcctcctgagaaatcctggaaatcaagctgcttatgagcattttgagacaatgaaaaac
caatggattgataatgtagaaaagatgacagggctggtggatgaggccatcgataccaag
tctctgttggatgcatcagaagaggctattaagaaggatcttgataaatgtaaagttgca
atggccaatatgcaacctcagatgctggtagctggagccaccagcattgctagacgagcg
aaccgcatcctgcttgtggcaaaacgggaggttgaaaattcagaagaccctaaattcagg
gaggctgttaaagcagcttctgatgagctgagcaaaaccatatcaccgatggtaatggat
gctaaagctgtagcaggaaatatctctgatcctggtttgcagaagagtttcttggattct
ggatacaggattctgggagctgtggccaaagtcagagaagcctttcagcctcaggagcca
gactttccccctcctcctcctgacctcgagcatctccatctgactgatgagcttgctcct
ccaaaaccaccacttccagaaggtgaggttcccccacccagaccaccaccccctgaagaa
aaagatgaggagttcccagagcagaaagcaggagaagctattaatcagcccatgatgatg
gctgctaggcagttgcatgacgaggctcggaaatggtctagcaagggtaacgacatcatt
gctgctgctaaacgaatggcgctgctcatggctgagatgtcacgcctggtgcgaggaggc
agcggaaacaagcgtgccctcatccagtgtgcaaaagatattgctaaggcatcggatgaa
gtcactcgattggccaaagaggtggccaagcaatgtactgataaacgcattagaacaaac
ctcttacaggtctgtgagcgaatcccaaccatcagcacgcagctcaaaattctttccaca
gtgaaagctaccatgctgggcaggactaacatcagcgatgaagaatcagaacaggcaact
gagatgttggttcataacgcccagaacctcatgcagtctgtgaaggaaactgtgagagaa
gctgaagcagcatccattaagataagaacagatgccggattcactctgcgctgggtcaga
aagaccccatggtatcagtaa

DBGET integrated database retrieval system