KEGG   Gallus gallus (chicken): 396433
Entry
396433            CDS       T01006                                 

Gene name
TNNT2
Definition
(RefSeq) troponin T, cardiac muscle isoforms
  KO
K12045  troponin T, cardiac muscle
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396433 (TNNT2)
   04261 Adrenergic signaling in cardiomyocytes
    396433 (TNNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    396433 (TNNT2)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     396433 (TNNT2)
SSDB
Motif
Pfam: Troponin DUF4250
Other DBs
NCBI-GeneID: 396433
NCBI-ProteinID: NP_990780
CGNC: 176
Ensembl: ENSGALG00000000302
UniProt: P02642
Position
26
AA seq 302 aa
MSDSEEVVEEYEQEQEEEYVEEEEEEWLEEDDGQEDQVDEEEEETEETTAEEQEDETKAP
GEGGEGDREQEPGEGESKPKPKPFMPNLVPPKIPDGERLDFDDIHRKRMEKDLNELQALI
EAHFESRKKEEEELISLKDRIEQRRAERAEQQRIRSEREKERQARMAEERARKEEEEARK
KAEKEARKKKAFSNMLHFGGYMQKSEKKGGKKQTEREKKKKILSERRKPLNIDHLSEDKL
RDKAKELWQTIRDLEAEKFDLQEKFKRQKYEINVLRNRVSDHQKVKGSKAARGKTMVGGR
WK
NT seq 909 nt   +upstreamnt  +downstreamnt
atgtcggactctgaagaggtcgttgaggaatacgagcaggagcaggaagaggagtatgtg
gaagaagaagaggaagaatggcttgaggaagacgacggtcaggaggatcaggtagacgag
gaggaagaggagacagaggaaaccacggcagaagaacaagaagatgaaacaaaagcacca
ggagaaggtggtgagggggaccgggagcaggagcctggggaaggtgaatcaaagcccaaa
cccaagcccttcatgcccaacctggtgcctcccaaaatccctgatggcgagcgcctggat
ttcgatgacatccaccgcaagcgcatggagaaggacctgaatgagctgcaggccctcatc
gaagcccattttgagagcaggaagaaggaggaagaggagctcatctctctcaaggacagg
attgagcagcggagggcagagagggcagagcagcagcgcatccgcagcgagagggagaag
gagcgccaggcccgcatggctgaggagagagctcgcaaagaggaagaggaggcacggaag
aaggctgagaaagaagctcggaaaaagaaagctttctccaacatgctgcactttggaggc
tacatgcagaagtcggagaagaagggtggcaagaagcaaacggagcgggagaagaagaaa
aagatcctcagcgagcggcggaagcctctgaacatcgaccacctcagcgaagacaaactg
agggacaaagccaaggagctgtggcaaaccatccgtgacctggaggctgagaaatttgac
ttgcaggagaagttcaagcggcagaagtacgagatcaacgtccttcgaaatcgtgtcagt
gaccaccagaaggtcaaagggtcaaaggctgcccgtgggaagaccatggtgggcggccgg
tggaagtag

DBGET integrated database retrieval system