KEGG   Gallus gallus (chicken): 396437
Entry
396437            CDS       T01006                                 

Gene name
TXN
Definition
(RefSeq) thioredoxin
  KO
K03671  thioredoxin 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04621  NOD-like receptor signaling pathway
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    396437 (TXN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396437 (TXN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    396437 (TXN)
Chaperones and folding catalysts [BR:gga03110]
 Protein folding catalysts
  Protein disulfide isomerase
   396437 (TXN)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 AhpC-TSA DIM1 Glutaredoxin OST3_OST6 Thioredoxin_9 Redoxin
Other DBs
NCBI-GeneID: 396437
NCBI-ProteinID: NP_990784
CGNC: 49804
Ensembl: ENSGALG00000015704
UniProt: P08629
Position
Z
AA seq 105 aa
MVKSVGNLADFEAELKAAGEKLVVVDFSATWCGPCKMIKPFFHSLCDKFGDVVFIEIDVD
DAQDVATHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaagagcgtgggcaatctggctgattttgaggcagaactgaaagctgctggtgag
aagcttgtagtagttgatttctctgccacatggtgtggaccatgtaaaatgatcaagcca
tttttccatagtctgtgtgacaagtttggtgatgtggtgttcattgaaattgatgtggat
gatgcccaagatgttgctacacactgtgatgtgaagtgcatgccaacattccagttctac
aagaacggaaagaaggtgcaggaattctctggggccaataaagagaagctggaagagacc
attaaaagtctagtctaa

DBGET integrated database retrieval system