KEGG   Gallus gallus (chicken): 396442Help
Entry
396442            CDS       T01006                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04137  Mitophagy - animal
gga04144  Endocytosis
gga04370  VEGF signaling pathway
gga04510  Focal adhesion
gga04520  Adherens junction
gga04530  Tight junction
gga04540  Gap junction
gga04625  C-type lectin receptor signaling pathway
gga04810  Regulation of actin cytoskeleton
gga04912  GnRH signaling pathway
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    396442 (SRC)
   04370 VEGF signaling pathway
    396442 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    396442 (SRC)
   04137 Mitophagy - animal
    396442 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396442 (SRC)
   04520 Adherens junction
    396442 (SRC)
   04530 Tight junction
    396442 (SRC)
   04540 Gap junction
    396442 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396442 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    396442 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    396442 (SRC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    396442 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396442 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    396442 (SRC)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     396442 (SRC)
Protein kinases [BR:gga01001]
 Non-receptor tyrosine kinases
  SRC family
   396442 (SRC)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    396442 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    396442 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    396442 (SRC)
  Macropinocytosis
   Kinases
    396442 (SRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_10 SH3_3 hSH3
Motif
Other DBs
NCBI-GeneID: 396442
NCBI-ProteinID: NP_990788
CGNC: 49807
Ensembl: ENSGALG00000003855
UniProt: P00523
Structure
PDB: 

Position
20
AA seq 533 aa AA seqDB search
MGSSKSKPKDPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWL
AHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT
KGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHR
LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPG
TMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRL
PQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQ
GAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLDQVERGYR
MPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTATEPQYQPGDNL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggggagcagcaagagcaagcccaaggaccccagccagcgccggcgcagcctggagcca
cccgacagcacccaccacgggggattcccagcctcgcagacccccaacaagacagcagcc
cccgacacgcaccgcacccccagccgctcctttgggaccgtggccaccgagcccaagctc
ttcgggggcttcaacacttctgacaccgtcacgtcgcctcagcgtgccggggcactggct
ggcggcgtcaccactttcgtggctctctacgactacgagtcccggactgaaacggacttg
tccttcaagaaaggagaacgcctgcagattgtcaacaacacggaaggtgactggtggctg
gctcattccctcactacaggacagacgggctacatccccagtaactatgtcgcgccctca
gactccatccaggctgaagagtggtactttgggaagatcactcgtcgggagtccgagcgg
ctgctgctcaaccccgaaaacccccggggaaccttcttggtccgggagagcgagacgaca
aaaggtgcctattgcctctccgtttctgactttgacaacgccaaggggctcaatgtgaag
cactacaagatccgcaagctggacagcggcggcttctacatcacctcacgcacacagttc
agcagcctgcagcagctggtggcctactactccaaacacgctgatggcttgtgccaccgc
ctgaccaacgtctgccccacgtccaagccccagacccagggactcgccaaggacgcgtgg
gaaatcccccgggagtcgctgcggctggaggtgaagctggggcagggctgctttggagag
gtctggatggggacctggaacggcaccaccagagtggccataaagactctgaagcccggc
accatgtccccggaggccttcctgcaggaagcccaagtgatgaagaagctccggcatgag
aagctggttcagctgtacgcagtggtgtcggaagagcccatctacatcgtcactgagtac
atgagcaaggggagcctcctggatttcctgaagggagagatgggcaagtacctgcggctg
ccacagctcgtcgatatggctgctcagattgcatccggcatggcctatgtggagaggatg
aactacgtgcaccgagacctgcgggcggccaacatcctggtgggggagaacctggtgtgc
aaggtggctgactttgggctggcacgcctcatcgaggacaacgagtacacagcacggcaa
ggtgccaagttccccatcaagtggacagccccggaggcagccctctatggcaggttcacc
atcaagtcggacgtctggtccttcggcatcctgctgactgagctggtaaccaaaggccgg
gtgccatacccagggatggtcaacagggaggtgctggaccaggtggagaggggctaccgc
atgccctgcccgcccgagtgccccgagtcgctgcatgacctcatgtgccagtgctggcgg
aaggaccctgaggagcggccaacttttgagtacctgcaggccttcctggaggactacttc
actgctacagagccccagtaccagcctggggacaacctatag

DBGET integrated database retrieval system