KEGG   Gallus gallus (chicken): 396445Help
Entry
396445            CDS       T01006                                 

Gene name
MYLK
Definition
(RefSeq) myosin light chain kinase, smooth muscle isoform 1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    396445 (MYLK)
   04020 Calcium signaling pathway
    396445 (MYLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396445 (MYLK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396445 (MYLK)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    396445 (MYLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396445 (MYLK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     396445 (MYLK)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   396445 (MYLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 Pkinase 23ISL V-set Pkinase_Tyr C2-set_2 fn3 Ig_6 Receptor_2B4 Izumo-Ig Herpes_gE Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 396445
NCBI-ProteinID: NP_001309290
CGNC: 8898
Ensembl: ENSGALG00000011708
UniProt: A0A1L1RRF3
Position
7
AA seq 1963 aa AA seqDB search
MPGLERRRREFPAALSDPLPNRPLRERPRGCDGERRSPPAPLPECAEPRASGPRVHIMGD
VKLVTSTRVSKTSLTLSPSVPAEAPAFTLPPRNIRVQLGATARFEGKVRGYPEPQITWYR
NGHPLPEGDHYVVDHSIRGIFSLVIKGVQEGDSGKYTCEAANDGGVRQVTVELTVEGNSL
KKYSLPSSAKTPGGRLSVPPVEHRPSIWGESPPKFATKPNRVVVREGQTGRFSCKITGRP
QPQVTWTKGDIHLQQNERFNMFEKTGIQYLEIQNVQLADAGIYTCTVVNSAGKASVSAEL
TVQGPDKTDTHAQPLCMPPKPTTLATKATENSDFKQATSNGIVTELKSTSTELMVETKDR
LSAKKETFYTSREAKDGKQGQNQEANAVPLQESRGTKGPQVLQKTSSTITLQAVKAQPEP
KAEPQTTFIRQAEDRKRTVQPLMTTTTQENPSLTGQVSPRSRETENRAGVRKSVKEEKRE
PLGIPPQFESRPQSLEASEGQEIKFKSKVSGKPKPDVEWFKEGVPIKTGEGIQIYEEDGT
HCLWLKKACLGDSGSYSCAAFNPRGQTSTSWLLTVKRPKVEEVAPCFSSVLKGCTVSEGQ
DFVLQCYVGGVPVPEITWLLNEQPIQYAHSTFEAGVAKLTVQDALPEDDGIYTCLAENNA
GRASCSAQVTVKEKKSSKKAEGTQAAKLNKTFAPIFLKGLTDLKVMDGSQVIMTVEVSAN
PCPEIIWLHNGKEIQETEDFHFEKKGNEYSLYIQEVFPEDTGKYTCEAWNELGETQTQAT
LTVQEPQDGIQPWFISKPRSVTAAAGQNVLISCAIAGDPFPTVHWFKDGQEITPGTGCEI
LQNEDIFTLILRNVQSRHAGQYEIQLRNQVGECSCQVSLMLRESSASRAEMLRDGRESAS
SGERRDGGNYGALTFGRTSGFKKSSSETRAAEEEQEDVRGVLKRRVETREHTEESLRQQE
AEQLDFRDILGKKVSTKSFSEEDLKEIPAEQMDFRANLQRQVKPKTLSEEERKVHAPQQV
DFRSVLAKKGTPKTPLPEKVPPPKPAVTDFRSVLGAKKKPPAENGSASTPAPNARAGSEA
QNATPNSEAPAPKPVVKKEEKNDRKCEHGCAVVDGGIIGKKAENKPAASKPTPPPSKGTA
PSFTEKLQDAKVADGEKLVLQCRISSDPPASVSWTLDSKAIKSSKSIVISQEGTLCSLTI
EKVMPEDGGEYKCIAENAAGKAECACKVLVEDTSSTKAAKPAEKKTKKPKTTLPPVLSTE
SSEATVKKKPAPKTPPKAATPPQITQFPEDRKVRAGESVELFAKVVGTAPITCTWMKFRK
QIQENEYIKIENAENSSKLTISSTKQEHCGCYTLVVENKLGSRQAQVNLTVVDKPDPPAG
TPCASDIRSSSLTLSWYGSSYDGGSAVQSYTVEIWNSVDNKWTDLTTCRSTSFNVQDLQA
DREYKFRVRAANVYGISEPSQESEVVKVGEKQEEELKEEEAELSDDEGKETEVNYRTVTI
NTEQKVSDVYNIEERLGSGKFGQVFRLVEKKTGKVWAGKFFKAYSAKEKENIRDEISIMN
CLHHPKLVQCVDAFEEKANIVMVLEMVSGGELFERIIDEDFELTERECIKYMRQISEGVE
YIHKQGIVHLDLKPENIMCVNKTGTSIKLIDFGLARRLESAGSLKVLFGTPEFVAPEVIN
YEPIGYETDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKD
FISNLLKKDMKSRLNCTQCLQHPWLQKDTKNMEAKKLSKDRMKKYMARRKWQKTGHAVRA
IGRLSSMAMISGMSGRKASGSSPTSPINADKVENEDAFLEEVAEEKPHVKPYFTKTILDM
EVVEGSAARFDCKIEGYPDPEVMWYKDDQPVKESRHFQIDYDEEGNCSLTISEVCGDDDA
KYTCKAVNSLGEATCTAELLVETMGKEGEGEGEGEEDEEEEEE
NT seq 5892 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcttggagcgtcggaggcgggagttccccgcagctctgtcggacccgctaccg
aaccgtcccctgcgggagcggccgcggggctgcgacggggagaggcgctcacctccagct
ccgctcccggagtgcgccgagccgagagcgagcggaccgcgggtccacatcatgggggat
gttaaactggtgacatctactcgagtatccaaaacctccctgacactcagtccctcggtt
cctgctgaagcaccagcatttactcttcctcctcggaatatccgagtgcaactgggagcc
acagcaagatttgaggggaaggtcagaggctaccctgagccacagatcacatggtacaga
aatggacatcctctcccagaaggagaccattatgttgtggaccacagcattcgggggata
ttcagcttggtgatcaaaggcgtgcaggaaggtgatagtggtaaatacacctgtgaggct
gccaatgatggtggggttcgtcaagtgactgtggaattgactgtggaaggaaattccttg
aagaaatacagcctaccatccagtgccaaaacccctgggggaagactaagtgttccacct
gtggagcataggccaagcatctggggagagagtccaccaaagtttgctacaaaacccaat
agagttgttgtgcgtgaaggccaaacaggcagattctcatgtaaaataacaggacgacct
cagcctcaagtaacttggactaagggtgatattcatctgcagcaaaatgagcgtttcaac
atgtttgagaaaacaggaatccagtacttggaaatccaaaacgttcagcttgctgatgca
ggaatttacacgtgcacggtggtaaacagtgctgggaaagcatctgtgtctgcagagctc
acagttcaaggtccagataagactgacacacatgctcagccactatgcatgccaccaaaa
ccaacaacgcttgctactaaagctactgaaaactcagatttcaaacaggcaactagcaat
gggattgttacagagctaaaatctaccagcactgaactcatggttgaaaccaaagacagg
ctatcagcaaagaaagagaccttttacacctccagagaagccaaagatggtaagcaggga
cagaaccaagaagccaatgcagtacctcttcaagaatctagaggaaccaaggggcctcag
gtcttacagaaaacttcaagcaccatcacactacaagctgtcaaagcacaaccagaacca
aaggcagaaccccagactactttcatcagacaggctgaagacaggaaaaggactgtgcag
cccctgatgacaactacaactcaagaaaacccttctctgacaggacaagtaagtccaagg
agtagagaaacagaaaacagagctggagtccggaagtctgtaaaggaggaaaagagagag
cctttgggaattcctccccagtttgagagccgcccacagagcctggaagcatcagaagga
caggagattaaattcaagagcaaagtttcagggaaaccaaaaccagatgtggagtggttc
aaagagggtgtacctattaaaactggagaaggtattcaaatttatgaagaagatggtact
cattgcttatggttaaagaaagcctgcctgggggacagtggatcttacagctgtgcagct
ttcaaccccagaggccaaacttccaccagctggttgttaactgtcaaaaggcctaaagtt
gaagaggttgctccatgcttttccagtgtcttgaaaggatgcactgtgagtgaagggcaa
gactttgtgctgcagtgctacgtaggaggtgtacctgtgcctgagatcacatggcttctc
aatgaacaaccaattcagtatgcccattccactttcgaagctggagttgcaaaactgact
gttcaagatgccttgccagaagatgatggcatttatacatgtctggctgaaaacaatgca
ggacgggcatcatgcagtgctcaggtcacagtcaaagaaaagaagagcagcaagaaggca
gaaggtacacaggctgccaaattaaacaagacttttgcacccatcttccttaaagggctg
actgacctcaaagtaatggatggaagtcaagtgataatgactgtggaagtatcagctaac
ccatgtcctgaaattatctggctgcacaatgggaaagaaatccaggagacagaagatttt
cactttgagaagaaaggcaatgaatacagtctgtacatccaggaagtatttcctgaagac
acaggcaaatacacctgtgaagcctggaatgaattaggagaaactcaaacacaggctaca
ttgacagtgcaggagcctcaggatggcattcagccgtggttcattagcaaaccgagatca
gtgacagcagctgctgggcaaaatgtccttatatcttgtgccattgctggagatcctttc
cccactgttcactggtttaaagatgggcaagaaataacaccaggaacaggctgtgaaatc
ctgcaaaatgaagatatcttcacactgatcttgaggaatgtacagtctcgtcatgcaggg
caatatgaaattcagctcaggaaccaagttggagaatgcagctgccaggtgtctctgatg
ctgcgagagagttcagcttccagagcagaaatgctcagagatgggagggaatcagccagc
tctggagagcgaagagatggtggaaattatggtgcactaacatttggtagaacaagtggc
ttcaaaaagagcagcagtgaaaccagagcagctgaggaagagcaggaagacgtccgaggc
gtactgaagaggcgagtggaaactcgggaacacacagaggagagcctgaggcagcaggaa
gctgaacagcttgatttccgtgacattttaggcaagaaagtcagcaccaaaagtttttct
gaggaggatctgaaagaaatcccagccgagcaaatggacttccgagcaaacctgcagcgg
caggtcaaacccaagaccttgtcagaggaggaaaggaaagttcatgctcctcagcaggtg
gacttccgctccgtgctggccaagaaaggcaccccaaagaccccactgccagagaaggtg
ccacctcctaagccagccgttacagatttcagatctgtgctgggtgcaaagaagaagccc
cctgcagagaatggcagcgctagcaccccagcaccaaatgcccgtgccggttctgaagca
cagaatgccacccccaattctgaagcccctgctcccaaaccagtagtgaaaaaagaagag
aagaatgacaggaaatgtgaacatgggtgtgcagtggtggatggaggaataattgggaaa
aaagctgaaaacaaaccagcagcaagcaagccaacaccaccaccaagcaaaggaacagca
ccatcctttacagagaagcttcaggatgctaaagtagcagatggtgaaaaattggtctta
caatgtcgaatttcctctgatccccctgcatctgtcagctggacgctagacagcaaagcc
atcaaatcatccaagtccattgtcatctcccaagaaggaacactgtgttcactaaccatt
gagaaggtcatgccagaagatggaggagaatacaaatgcatagcagagaatgcagcagga
aaagcagaatgtgcttgcaaagtgcttgtggaagatacctcatccacaaaggctgcgaag
ccagctgagaaaaagaccaagaagcctaagaccacacttccccctgtgctgtcaacagaa
agcagtgaagcaacagtgaagaagaaaccagctccaaagactcctccaaaagcagctact
ccccctcagatcactcagttcccagaagacagaaaagtccgtgctggtgaatcagtggaa
ttgtttgccaaagtggtaggaacagcacccataacttgcacctggatgaaattccgtaag
cagattcaagaaaatgaatatatcaaaattgagaatgctgaaaacagcagcaagctaaca
atatcatcgacaaagcaggaacactgcggatgttacacgctagttgtagaaaacaaactt
ggcagcagacaagcacaagtcaaccttacagttgttgataaaccagacccacctgctgga
acgccttgtgcatcagacatacggagttcttccctcactctttcatggtacggctcctct
tatgatggtggaagtgcggtgcagtcctacactgtggagatctggaactcagtggataac
aaatggacagacctcactacctgccgcagcacgtctttcaacgtgcaggacctgcaggct
gaccgggagtacaaattccgtgtacgagctgctaacgtgtacggcatcagtgagcccagt
caagaatctgaggtggtaaaagttggagagaaacaagaagaagaacttaaagaggaggaa
gcagagctgtctgacgatgaaggcaaagaaacagaggtcaactatcggacagttactatc
aacaccgaacagaaagtttcagatgtctataatattgaagaaagactgggatcggggaaa
tttggacaagtctttaggcttgttgaaaagaagactggaaaagtgtgggcaggaaaattt
ttcaaagcatattctgcaaaggaaaaagagaacataagggatgaaatcagcatcatgaac
tgtctgcatcacccaaagctcgtgcaatgtgtagatgcctttgaagaaaaagccaacatt
gttatggtcttggaaatggtttctggaggagaactctttgaacgtatcattgatgaagac
tttgaactgacagagagagaatgcattaaatatatgaggcagatttcagaaggagttgag
tacatccataagcagggtattgtccatttggatttgaagccagaaaatattatgtgtgtc
aacaagactggtacaagtatcaaactcattgacttcggacttgcaagaagattagaaagt
gcaggttctctcaaagttctctttgggacacctgagtttgtggctccagaagttataaac
tatgaacctatcggatatgaaacagatatgtggagtataggagttatctgctacatcctg
gtcagcgggctttctcccttcatgggagacaacgacaacgagaccctggccaacgtcacc
tctgccacgtgggacttcgatgatgaggcttttgatgaaatctctgacgatgccaaggac
tttatcagcaatctcctgaagaaagacatgaagagtcgcttaaattgtactcaatgtctt
cagcacccgtggctgcaaaaagacaccaaaaacatggaagccaaaaaactttccaaagat
aggatgaagaaatatatggccagaagaaaatggcagaaaacaggccatgctgtccgagca
ataggaagactgtcatccatggcaatgatttctggtatgagtgggaggaaggcctctggg
agctcgcctaccagcccgataaatgcagacaaagtagagaacgaagatgccttccttgaa
gaagtggctgaggaaaagccccatgtaaagccatactttactaaaacaatccttgacatg
gaggttgtggaaggaagtgctgctaggtttgactgcaaaatcgaaggctatcctgaccct
gaggtaatgtggtacaaagatgatcagcctgtcaaggagtcccgtcacttccagatagat
tatgatgaggaagggaactgttctttgactatttctgaagtatgtggggacgatgatgcc
aaatacacctgcaaagctgttaacagccttggggaagccacatgtaccgcagaactcctt
gtggaaacaatgggaaaagagggagaaggagaaggagaaggagaagaagatgaagaggag
gaggaagaatga

DBGET integrated database retrieval system