KEGG   Gallus gallus (chicken): 396483
Entry
396483            CDS       T01006                                 

Gene name
TIMP3
Definition
(RefSeq) metalloproteinase inhibitor 3 precursor
  KO
K16866  metalloproteinase inhibitor 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    396483 (TIMP3)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I35: timp family
   396483 (TIMP3)
SSDB
Motif
Pfam: TIMP
Other DBs
NCBI-GeneID: 396483
NCBI-ProteinID: NP_990818
CGNC: 9540
Ensembl: ENSGALG00000028627
UniProt: P26652
Position
1
AA seq 212 aa
MTAWLGFLAVFLCSWSLRDLVAEACTCVPIHPQDAFCNSDIVIRAKVVGKKLMKDGPFGT
MRYTVKQMKMYRGFQIMPHVQYIYTEASESLCGVKLEVNKYQYLITGRVYEGKVYTGLCN
WYEKWDRLTLSQRKGLNHRYHLGCGCKIRPCYYLPCFATSKNECIWTDMLSNFGHSGHQA
KHYACIQRVEGYCSWYRGWAPPDKTIINATDP
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacggcgtggctcggcttcctcgccgtgttcctgtgcagctggagcctgcgggacctg
gtggcggaggcgtgcacttgcgtccccatccacccgcaggacgcgttctgcaactccgac
atcgtgatccgtgctaaagttgtggggaagaagctcatgaaagatggaccatttggaaca
atgcgatacacagtcaagcagatgaagatgtacaggggcttccagataatgccacacgtt
cagtacatctacacagaagcctcagagagtctttgtggtgtgaaactggaggtcaacaaa
taccagtatctgattacaggccgcgtgtacgaagggaaggtttacactggcctgtgcaat
tggtatgagaaatgggaccgactgactctgtcccagcgtaaaggactgaatcatcgttat
catctgggctgtggatgcaagattcggccctgctactatttgccctgctttgccacctcc
aagaatgagtgcatttggacagacatgctctccaacttcggccactcaggacaccaagcg
aagcactatgcctgcatccagagggtggaaggttactgcagctggtatagaggatgggcg
cctccagataaaacgatcatcaatgccacagatccctga

DBGET integrated database retrieval system