KEGG   Gallus gallus (chicken): 396491Help
Entry
396491            CDS       T01006                                 

Gene name
CG-1B
Definition
(RefSeq) beta-galactoside-binding lectin
  KO
K06830  galectin-1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396491 (CG-1B)
   04091 Lectins [BR:gga04091]
    396491 (CG-1B)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   396491 (CG-1B)
Lectins [BR:gga04091]
 S-type lectins (Galectins)
  396491 (CG-1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-bind_lectin partial_CstF
Motif
Other DBs
NCBI-GeneID: 396491
NCBI-ProteinID: NP_990826
CGNC: 49833
Ensembl: ENSGALG00000012420
UniProt: P07583
Structure
PDB: 

Position
1
AA seq 135 aa AA seqDB search
MSCQGPVCTNLGLKPGQRLTVKGIIAPNAKSFVMNLGKDSTHLGLHFNPRFDAHGDVNLI
VCNSKKMEEWGTEQRETVFPFQKGAPIEITFSINPSDLTVHLPGHQFSFPNRLGLSVFDY
FDTHGDFTLRSVSWE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtcagggaccagtgtgcaccaacttgggtctcaagcctggccagcgcctcact
gtcaaggggataatcgcaccgaatgccaaaagctttgtgatgaatctgggcaaggactca
acccacctggggcttcacttcaacccccgctttgatgctcacggtgatgtgaacctcatt
gtgtgcaactcaaagaaaatggaagagtggggtaccgagcaaagggagacggtcttccct
ttccagaagggagccccaatagagatcactttcagcatcaacccaagcgatctgactgtc
cacctgccaggccaccaattctcattccccaaccggcttggtctttctgtctttgactac
tttgatacgcatggagacttcacgctccggtctgtcagctgggagtaa

DBGET integrated database retrieval system