KEGG   Gallus gallus (chicken): 396500Help
Entry
396500            CDS       T01006                                 

Gene name
REL
Definition
(RefSeq) proto-oncogene c-Rel
  KO
K09254  c-Rel proto-oncogene protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396500 (REL)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    396500 (REL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 396500
NCBI-ProteinID: NP_001161198
CGNC: 5934
Ensembl: ENSGALG00000007845
UniProt: P16236
Structure
PDB: 

Position
3
AA seq 598 aa AA seqDB search
MAGISEPYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFGKVKI
RTTLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGIQCVKKKDLKESISL
RISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHGNYTLALPPLISNPIYDNRAP
NTAELRICRVNKNCGSVKGGDEIFLLCDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVA
IVFRTPPFLRDITEPITVKMQLRRPSDQEVSEPMDFRYLPDEKDPYGNKAKRQRSTLAWQ
KLIQDCGSAVTERPKAVPIPTVNPEGKLIKKEPNMFSPTLMLPGLGTLTSSSQMYPPCSQ
MPHQPAQLGPGKQDTLPSCWQQLFSSSPSASSLLSMHPHNSFTAEVPQPSAQGSSSLPAF
HDNPLNWPDEKDSSFYRNFGSTNGMGAAMVSAADMQSASSNSIVHATHQASATAASIVNM
ETNDMNCTSLNFEKYTQVLNVSNHRQQLHQAPAACPPVAAPGSTPFSSQPNLADTAVYNS
FLDQEVISDSRLSTNPLQNHQNSLTLTDNQFYDTDGVHTDELYQSFQLDTNILQSYNH
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtatctcagagccctacattgaaatatttgaacaacccaggcaaaggggcatg
cgtttcagatacaaatgtgaaggaagatcagcaggtagcattccaggagaacacagtact
gacaacaacaagacattcccatctatacagattctgaactattttggaaaagtcaaaata
agaactacattggtaacaaagaatgaaccctacaagccacaccctcatgatctagttgga
aaagactgcagagatggctactatgaagcagagtttgggcctgaacgtcgagtcctgtct
tttcagaatttgggaattcaatgtgtgaagaagaaagacctgaaagaatcaatttctttg
cgaatctcaaagaagatcaacccctttaatgtgcctgaagaacagctgcacaacatcgat
gaatatgatctcaacgttgtccgcctctgtttccaagctttcctccctgatgaacatggc
aactacacattagctcttcctcctttgatttccaacccaatctatgacaacagagctccc
aacacagcagaactgagaatttgccgtgtgaataagaactgtggaagtgtaaagggagga
gatgaaatttttcttctgtgtgataaagttcaaaaagatgacatagaagtcagatttgtc
ttggacaactgggaggcaaaaggctccttctcccaagctgatgttcatcgccaggttgca
attgtgttcagaacaccgccattcctcagagacatcacagaacccatcacggtgaagatg
cagttacgaagaccttcagaccaggaagtcagtgaaccaatggatttcagatacctacca
gatgaaaaggatccatatggtaacaaagcaaaaaggcaaagatcaacgctggcctggcaa
aagctcatacaggactgtggatcagctgtgacagagaggccaaaagcagttccaatcccc
actgtcaaccctgaaggaaagctgattaagaaagaaccaaatatgttttcacctacactg
atgctgcctgggctaggaacgctgacgagctccagccagatgtaccctccatgcagccag
atgccccaccagcctgcgcagcttggccctggaaagcaggacacactcccttcctgctgg
cagcagctgttcagctcctccccttcagccagcagcctgctcagcatgcacccgcacaac
agcttcacagcagaagtgcctcagcccagtgctcagggcagtagctctctcccagctttc
cacgataacccactgaactggcctgatgagaaggattccagtttttacaggaattttggc
agcacaaatgggatgggagcagcgatggtgtcagctgcggatatgcagagtgcttccagt
aacagcatcgtccatgccactcatcaggccagtgccactgctgcgagcatcgtgaacatg
gagaccaatgacatgaactgcactagtctcaactttgaaaagtatactcaggtgttaaat
gtaagcaaccacaggcagcagctccatcaggcacctgcagcatgtccacctgtggcagcc
cctggcagcactcccttcagttcacaaccaaatttagctgatacagcagtttacaacagc
tttctagaccaagaagttataagtgattcaagactatcaaccaaccctctccagaaccat
cagaacagccttacccttacagataaccagttctatgacaccgatggtgtccacactgat
gagctctatcagtctttccagttagatacaaacatattacaaagctataaccattga

DBGET integrated database retrieval system