KEGG   Gallus gallus (chicken): 396505Help
Entry
396505            CDS       T01006                                 

Gene name
MATN1
Definition
(RefSeq) cartilage matrix protein precursor
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: VWA VWA_2 Matrilin_ccoil VWA_3 FXa_inhibition EGF_CA cEGF Plasmod_Pvs28 EGF hEGF EGF_3 Prefoldin_2
Motif
Other DBs
NCBI-GeneID: 396505
NCBI-ProteinID: NP_001025546
CGNC: 49841
Ensembl: ENSGALG00000043185
UniProt: A0A1D5PVS6
Structure
PDB: 

Position
23
AA seq 493 aa AA seqDB search
MDGIFCALPLSLLLLLQSCGVWGAPPQPRGTLCRTKPTDLVFIIDSSRSVRPQEFEKVKV
FLSRVIEGLDVGPNSTRVGVINYASAVKNEFSLKTHQTKAELLQAVQRIEPLSTGTMTGL
AIQFAISRAFSDTEGARLRSPNINKVAIVVTDGRPQDGVQDVSARARQAGIEIFAIGVGR
VDMHTLRQIASEPLDDHVDYVESYSVIEKLTHKFQEAFCVVSDLCATGDHDCEQICISTP
GSYKCACKEGFTLNNDGKTCSACSGGSGSALDLVFLIDGSKSVRPENFELVKKFINQIVE
SLEVSEKQAQVGLVQYSSSVRQEFPLGQFKNKKDIKAAVKKMAYMEKGTMTGQALKYLVD
SSFSIANGARPGVPKVGIVFTDGRSQDYITDAAKKAKDLGFRMFAVGVGNAVEDELREIA
SEPVAEHYFYTADFRTISNIGKKLQMKICIEEDPCECKSIVKFQTKVEELINTLQQKLEA
VAKRIEALENKII
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggacgggattttctgcgccttgccactctctttgctgcttctcctccagagctgtgga
gtctggggggcacctcctcagcccagaggcaccctgtgcagaaccaaacccaccgacctg
gtgttcatcattgacagctctcggagcgtgcgcccgcaagagttcgagaaagtcaaagtc
ttcctgtcgcgggtgatcgagggcctggacgtgggccccaactccacgcgggttggggtc
atcaattacgccagtgcagtcaagaacgagttctccctcaagactcaccaaaccaaagcc
gagctcctgcaggcggtccagaggatagagccactctccacagggaccatgaccggcttg
gccatccagtttgccatcagccgggccttcagtgacacagaaggggccaggctgagatct
cccaatattaataaggtggcgattgttgtgaccgatggacgtccccaggacggagtgcag
gacgtgtcagcgagggccaggcaggctggcattgagatcttcgccatcggggttggccgg
gtggacatgcacacgctacggcaaatcgcaagcgagcccctggacgaccacgtggactac
gtggagagctacagtgtcatagagaagctgacccacaagtttcaagaagcgttctgtgtg
gtgtcagacctgtgtgccactggcgaccatgactgtgagcagatctgtatcagcacccca
ggatcatacaagtgtgcttgtaaagagggcttcacgctgaacaatgatgggaagacctgc
agtgcttgcagtggtgggtcaggatctgccctggatctcgttttcctgatcgatggctcc
aagagtgttcggcctgagaactttgagctggtgaagaaattcatcaaccaaattgtggaa
tccctggaagtgtcagagaagcaggcccaggttggcctggttcagtactccagctctgtc
aggcaggagtttcctctgggacagttcaagaacaagaaggacatcaaagcagcagtcaag
aaaatggcctacatggagaaaggcaccatgacaggccaggctctgaagtacctcgtggac
agttccttttccattgctaatggggctaggcctggggttcccaaggtgggcatagtcttc
acagatggacggtcacaagattacatcactgatgctgctaagaaagccaaagatttaggc
tttaggatgtttgctgtgggagttggtaacgcagtggaggatgagctgagggaaattgct
tccgaaccagtagctgagcactacttctacacagccgacttcagaaccatcagcaacatt
gggaagaagctgcaaatgaaaatctgcattgaggaagatccatgcgaatgtaaatctata
gtgaagttccagacaaaagttgaagaactcatcaatacactgcaacagaaattggaagct
gtggcaaaaaggattgaagccctggagaataagatcatctag

DBGET integrated database retrieval system