KEGG   Gallus gallus (chicken): 396512
Entry
396512            CDS       T01006                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04210  Apoptosis
gga04620  Toll-like receptor signaling pathway
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396512 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    396512 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    396512 (FOS)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396512 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396512 (FOS)
   04131 Membrane trafficking [BR:gga04131]
    396512 (FOS)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    396512 (FOS)
Membrane trafficking [BR:gga04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    396512 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin HALZ DivIC
Other DBs
NCBI-GeneID: 396512
NCBI-ProteinID: NP_990839
CGNC: 49845
Ensembl: ENSGALG00000028037
UniProt: P11939
Position
5
AA seq 367 aa
MMYQGFAGEYEAPSSRCSSASPAGDSLTYYPSPADSFSSMGSPVNSQDFCTDLAVSSANF
VPTVTAISTSPDLQWLVQPTLISSVAPSQNRGHPYGVPAPAPPAAYSRPAVLKAPGGRGQ
SIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEEEKSALQA
EIANLLKEKEKLEFILAAHRPACKMPEELRFSEELAAATALDLGAPSPAAAEEAFALPLM
TEAPPAVPPKEPSGSGLELKAEPFDELLFSAGPREASRSVPDMDLPGASSFYASDWEPLG
AGSGGELEPLCTPVVTCTPCPSTYTSTFVFTYPEADAFPSCAAAHRKGSSSNEPSSDSLS
SPTLLAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgatgtaccagggcttcgctggggagtacgaggcgccctcctcccgctgcagcagcgct
tccccggccggggacagcctcacctactacccgtccccggcggactccttctccagcatg
ggttcccccgtcaactcgcaggatttctgcaccgacctggccgtgtccagcgccaacttc
gtgcccaccgtgacggccatctccaccagtcccgacctgcagtggctggtgcagcccacc
ctcatctcctcggtcgccccctcccagaaccgcgggcacccctacggcgttccggcgccc
gcccctcccgccgcttattcccgccccgccgtgttgaaggcgccgggcggccgcgggcag
agcatcggacgaaggggcaaagtcgagcagctgtccccggaggaggaggaaaagaggagg
atccgccgggagaggaacaagatggcagcggccaagtgccgcaaccggcggcgggagctc
accgacactctgcaggcggagacggaccagctggaggaggagaagtccgctctgcaggcg
gagatagccaacctgctgaaggagaaggagaagctggagttcatcctggcggcgcaccgg
cccgcctgcaagatgcccgaggagctgcgcttctccgaggagctggcggccgccaccgca
ctggacctgggcgcacccagccccgccgcggccgaggaggccttcgccctgccgctaatg
accgaggcgccgccggccgtgccgcccaaggagccgagcggcagcgggctggagctgaag
gccgagcccttcgacgagctgcttttctccgcggggccgcgggaggcctcccgctcggtg
cctgacatggacctgcccggagcctcctccttctacgcgtcggactgggagccgctgggc
gccgggagcggcggggagctggagcccctctgcacccccgtggtgacctgcaccccgtgc
cctagcacctacacctccaccttcgtcttcacctaccccgaggcggacgccttccccagc
tgcgccgctgcgcaccggaagggcagcagcagcaacgagccctcgtccgactccctcagc
tcccccaccctgctggccttgtga

DBGET integrated database retrieval system