KEGG   Gallus gallus (chicken): 396515
Entry
396515            CDS       T01006                                 

Gene name
FGFR3
Definition
(RefSeq) fibroblast growth factor receptor 3 precursor
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04144  Endocytosis
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396515 (FGFR3)
   04020 Calcium signaling pathway
    396515 (FGFR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    396515 (FGFR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396515 (FGFR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396515 (FGFR3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    396515 (FGFR3)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     396515 (FGFR3)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   396515 (FGFR3)
CD molecules [BR:gga04090]
 Proteins
  396515 (FGFR3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM Ig_5 Ig_4 Ig_6 C2-set_2 Pkinase_fungal Orthoreo_P10 INCENP_ARK-bind
Other DBs
NCBI-GeneID: 396515
NCBI-ProteinID: NP_990840
CGNC: 49846
Ensembl: ENSGALG00000015708
UniProt: P18460
Position
4
AA seq 827 aa
MSEAGGGAAAAASLPRSRAGGMRAAWGSVWCLCLAAAVGALPAARRRGAERSGGQAAEYL
RSETAFLEELVFGSGDTIELSCNTQSSSVSVFWFKDGIGIAPSNRTHIGQKLLKIINVSY
DDSGLYSCKPRHSNEVLGNFTVRVTDSPSSGDDEDDDDESEDTGVPFWTRPDKMEKKLLA
VPAANTVRFRCPAGGNPTPTIYWLKNGKEFKGEHRIGGIKLRHQQWSLVMESVVPSDRGN
YTCVVENKYGNIRHTYQLDVLERSPHRPILQAGLPANQTVVVGSNVEFHCKVYSDAQPHI
QWLKHVEVNGSKYGPDGTPYVTVLKTAGVNTTDKELEILYLRNVTFEDAGEYTCLAGNSI
GFSHHSAWLTVLPAEELMEMDDSGSVYAGILSYGTGLVLFILVLVIVIICRMKMPNKKAM
NTTTVQKVSKFPLKRQQVSLESNSSMNSNTPLVRITRLSSSDGPMLANVSELELPPDPKW
ELARSRLTLGKPLGEGCFGQVVMAEAIGIDKDKPNKAITVAVKMLKDDATDKDLSDLVSE
MEMMKMIGKHKNIINLLGACTQDGPLYVLVEYASKGNLREYLRARRPPGMDYSFDTCKLP
EEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNI
DYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFK
LLKEGHRMDKPANCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRVLTMTSTDEYLDLSV
PFEQYSPAGQDTHSTCSSGDDSVFAHDLLPDEPCLPKHVPCNGVIRT
NT seq 2484 nt   +upstreamnt  +downstreamnt
atgtctgaggcgggcggcggtgcggcggcggcggcctcgctgccccggagccgcgccgga
gggatgcgggcggcctggggctccgtctggtgcctgtgcctggcggcggccgtcggagcg
ctgccggcggcgcgccggcgcggagcggagcggagcggcgggcaggcggcagaatacttg
aggagcgagaccgcctttctggaagagttggtgtttggaagtggagataccattgaactt
tcctgtaacacccagagctcttctgtgtcagttttctggtttaaagatggtattgggatt
gcaccttccaacagaactcatattggacaaaaactgttgaagataatcaatgtgtcatat
gacgattcggggctgtacagttgcaagccaaggcattccaacgaggtcctgggaaacttt
acagtcagagtgacagattccccttcgtcaggtgatgatgaagatgatgacgatgagtca
gaggatacaggtgtccccttctggacccggccagataagatggagaagaagctgctggca
gttcctgccgccaacaccgttcgcttccgatgtccagcaggtggaaacccaactcccacc
atttactggctgaagaatggcaaagaattcaagggagagcacaggatcgggggcatcaag
ttgcgacaccagcagtggagcttggtgatggagagcgttgtgccgtcagatcgaggaaac
tacacctgtgttgtggagaacaaatatggcaatattaggcacacataccagcttgatgtt
ttagaacggtcaccccaccgaccaatcctgcaagcaggactccctgccaatcagactgtg
gtggtcgggagcaatgtggaatttcactgcaaggtctacagcgatgcccagcctcatatc
cagtggctgaaacacgtagaagtcaacggcagcaagtatggacctgatgggacaccctat
gtcacagtgctgaagacggcaggtgttaacacaacggataaggagctagagattctgtac
ttgcgaaatgttacttttgaggatgctggggaatatacttgtctcgcagggaattctatt
gggttctcacatcactctgcttggctgacggtgctaccagcagaggagctgatggaaatg
gatgattcgggctcagtgtacgctggcattctcagctatggcactggcttagtcctcttc
atcctggtgctggtcattgtgattatctgcaggatgaaaatgccaaacaaaaaggccatg
aacaccaccactgtacagaaagtctccaaatttccactcaagagacagcaggtgtcgttg
gagtccaactcttccatgaattccaacacacccctggtccggatcactcgtctctcctcc
agcgatgggccgatgctggccaacgtctctgagctggaacttcctccagatcccaagtgg
gaattggcacgttctcgcctgaccctggggaagccgcttggtgagggctgttttggccaa
gtggtgatggcggaagcaattgggattgataaagacaagccaaacaaggccatcaccgtg
gctgtcaagatgttaaaagatgatgccacagacaaggacctttcagacctggtctctgag
atggaaatgatgaaaatgattgggaagcacaaaaacatcattaacctgctcggtgcttgc
acgcaggacggaccgctctacgtgttggttgaatatgcatcgaaggggaacttgcgggaa
tacctcagggcacgtcgcccacctggcatggactattccttcgacacctgcaagctgccc
gaggagcagttgacatttaaagacctggtttcctgcgcctaccaggtggcccggggcatg
gagtacttggcgtcacagaaatgcattcatcgtgacttggcagccaggaatgtgttagtc
actgaggacaatgtgatgaaaatagctgattttggccttgctagagacgttcacaacatc
gactattacaagaaaaccaccaatggtcggctgcctgtgaaatggatggctccagaagca
ttgtttgaccgggtctatactcaccagagcgatgtctggtcttttggagtgctactatgg
gagatcttcactttgggagggtctccgtacccgggaattcctgttgaagaactcttcaaa
ctcttgaaagaaggccatcggatggataaacccgccaactgtacccacgacctgtacatg
atcatgcgggagtgctggcacgctgtcccctcgcagcgacccacattcaagcagctggtg
gaagacctggacagagtcctcaccatgacatccactgatgagtacctggacctctcggtg
ccctttgagcaatactcacccgctggccaggacacccacagcacctgctcctcaggggac
gactcggtttttgcacatgacctgctgcctgatgagccctgcctgcccaagcacgtgccc
tgtaatggcgtcatccgcacgtga

DBGET integrated database retrieval system