KEGG   Gallus gallus (chicken): 396516Help
Entry
396516            CDS       T01006                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 precursor
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04520  Adherens junction
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396516 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    396516 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396516 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396516 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:gga04090]
    396516 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    396516 (FGFR1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     396516 (FGFR1)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   396516 (FGFR1)
CD molecules [BR:gga04090]
 Proteins
  396516 (FGFR1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   396516 (FGFR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 ig Ig_2 V-set Ig_5 C2-set_2 Ig_4 DUF2890 DUF4396 DUF1615
Motif
Other DBs
NCBI-GeneID: 396516
NCBI-ProteinID: NP_990841
CGNC: 49847
Ensembl: ENSGALG00000039786
UniProt: P21804
Position
22
AA seq 819 aa AA seqDB search
MFTWRCLILWAVLVTATLSAARPAPTLPDQALPKANIEVESHSAHPGDLLQLRCRLRDDV
QSINWVRDGVQLPENNRTRITGEEVEVRDAVPEDSGLYACMTNSPSGSETTYFSVNVSDA
LPSAEDDDDEDDSSSEEKEADNTKPNQAVAPYWTYPEKMEKKLHAVPAAKTVKFKCPSGG
TPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENKYGSINHT
YQLDVVERSPHRPILQAGLPANKTVALGSNVEFVCKVYSDPQPHIQWLKHIEVNGSKIGP
DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGISHHSAWLTVLEAT
EQSPAMMTSPLYLEIIIYCTGAFLISCMVVTVIIYKMKSTTKKTDFNSQLAVHKLAKSIP
LRRQVTVSADSSSSMNSGVMLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLILGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGMEYCYNPTRIPEEQLSFKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVAMTSNQEYLDLSVPLDQYSPGFPA
TRSSTCSSGEDSVFSHDPLPDEPCLPRCPPHSHGALKRH
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtttacctggaggtgcctcatcctttgggctgtgctggtcacagccacgctgtctgct
gccagaccggcccccacgctgcccgaccaagctctgcccaaagcgaacatcgaggtggag
tcccactcggcgcaccccggcgatctcctccagctgcgctgccggctgcgcgatgacgtg
cagagcatcaactgggtgcgtgatggagtgcagctgcccgagaacaaccgcacgcgcatc
accggcgaggaggtagaggtgcgggacgcggtgcccgaggactcggggctctatgcctgc
atgaccaacagcccctcggggagcgagaccacctacttctccgtcaacgtctcagacgca
ctcccttctgcagaggatgatgatgatgaagatgattcctcctcggaggagaaggaggcg
gataacaccaagccgaaccaggctgtagctccttactggacctatcccgagaagatggag
aagaagctgcatgccgtccccgctgccaaaacagtgaaattcaagtgcccctcaggtggg
acgcccaaccccacgctgcgctggctgaagaacggcaaggagttcaagcctgaccaccgc
atcggggggtacaaggtccgctatgccacctggagcatcatcatggactcggtggtgcca
tcagataagggcaactacacgtgcatcgtggagaacaaatacgggagcatcaaccacacc
taccagctggatgtcgtggagcgctccccgcatcggcccatcctgcaggcagggctcccc
gccaacaaaacggtggccctgggcagcaacgtggagtttgtctgcaaggtctacagcgac
ccgcagccccacatccagtggctgaaacacatcgaggtgaacggcagcaagatcggcccc
gacaacttgccctacgtgcagatcctgaagacggctggcgttaacacgacagacaaagag
atggaagtccttcacttaaggaatgtctcatttgaggatgctggggagtatacatgtttg
gcgggtaattctattgggatctcccatcactctgcatggttgacagttctcgaagctact
gagcagtcaccagccatgatgacgtcccccctctacctggagatcatcatttactgcacc
ggcgccttcctcatctcctgcatggtggtgacagtcatcatctacaagatgaagagcacc
accaagaagacagacttcaacagccagctggccgtgcacaagctggccaagagcatccca
ctgcgcagacaggtaacagtgtcagcagattccagctcctccatgaactcgggtgtgatg
ttggtgcggccctcacggctctcctccagcggaacccccatgctggccggcgtctccgag
tatgagctgcccgaggacccgcgctgggagctgccacgggacaggctgatcctgggcaag
ccgctgggagaaggctgctttgggcaggtggtgctggcggaggccatcggcctggacaag
gacaagccaaaccgcgtcaccaaagtggctgtaaagatgctcaagtccgatgccacagag
aaggacctgtccgacctcatctccgagatggagatgatgaagatgatcggcaagcacaag
aacatcatcaacctgctgggtgcctgcacgcaggacgggcccctctatgtcatcgtggag
tacgccagcaaaggcaacctgcgtgagtacctgcaggcacgccgcccaccgggcatggag
tactgctacaaccccacacgcatccccgaggagcagctctccttcaaggacctggtgtcc
tgtgcgtaccaggtggcgcgcggcatggagtacctggcctccaaaaagtgcatccacagg
gacctggcggccaggaacgtgctggtgaccgaggacaacgtgatgaagatcgctgacttc
gggctggcccgcgacatccaccacatcgattactacaagaagacgacaaacggccgcttg
ccggtgaagtggatggccccggaggctctgttcgaccgaatatacacccatcagagtgat
gtttggtcgttcggtgtgctgctgtgggagatcttcacgttgggtggttcgccctacccc
ggcgtgcccgtggaggagctcttcaagctgctgaaggaaggccacaggatggacaagccc
agcaactgcaccaacgagctgtacatgatgatgcgcgactgctggcacgccgtgccctcc
cagcgccccaccttcaagcagctggtggaggacctggacaggatcgtggccatgacctcc
aatcaggagtacctggacctgtcggtgccgttggatcagtactcgcccggcttcccggcc
acgcgcagctccacctgctcctcgggggaggactcggtgttctcccacgacccgctgccc
gacgagccctgcctgccgcgctgccccccgcacagccacggagcgctgaagcggcactga

DBGET integrated database retrieval system