KEGG   Gallus gallus (chicken): 396523Help
Entry
396523            CDS       T01006                                 

Gene name
CALM1
Definition
(RefSeq) neo-calmodulin
  KO
K02183  calmodulin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04744  Phototransduction
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    396523 (CALM1)
   04020 Calcium signaling pathway
    396523 (CALM1)
   04070 Phosphatidylinositol signaling system
    396523 (CALM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    396523 (CALM1)
   04218 Cellular senescence
    396523 (CALM1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    396523 (CALM1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    396523 (CALM1)
   04912 GnRH signaling pathway
    396523 (CALM1)
   04916 Melanogenesis
    396523 (CALM1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396523 (CALM1)
   04270 Vascular smooth muscle contraction
    396523 (CALM1)
  09157 Sensory system
   04744 Phototransduction
    396523 (CALM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    396523 (CALM1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    396523 (CALM1)
   03036 Chromosome and associated proteins [BR:gga03036]
    396523 (CALM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396523 (CALM1)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     396523 (CALM1)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    396523 (CALM1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     396523 (CALM1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   396523 (CALM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen Dockerin_1 Caleosin TerB DUF5580 DUF1103 SurA_N_2 Poly_export DUF2267 SurA_N_3 MotA_activ Fe_hyd_lg_C Spore_III_AB
Motif
Other DBs
NCBI-GeneID: 396523
NCBI-ProteinID: NP_001103834
CGNC: 49852
Ensembl: ENSGALG00000026445
UniProt: P05419
Structure
PDB: 

Position
5
AA seq 149 aa AA seqDB search
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDSNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccagctgaccgaagagcagattgctgaattcaaggaagccttttccctattt
gacaaagatggtgatggtactatcacaacaaaagaactgggaactgtcatgaggtcgctg
ggtcaaaatccaacagaagcagaattacaggatatgatcaacgaggtagatgctgatggt
aatggcactattgactttcctgaatttttaaccatgatggccagaaaaatgaaggacaca
gacagcgaggaagaaatccgtgaggcattccgagtctttgacaaggatagcaatggctat
atcagtgcagcagagctacgtcatgttatgacaaacttaggagaaaagctaacagacgaa
gaagtagatgaaatgatcagagaagcagacattgatggggatggacaagtcaactatgaa
gaattcgtacagatgatgactgcaaagtga

DBGET integrated database retrieval system