KEGG   Gallus gallus (chicken): 396526
Entry
396526            CDS       T01006                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04145  Phagosome
gga04210  Apoptosis
gga04510  Focal adhesion
gga04520  Adherens junction
gga04530  Tight junction
gga04810  Regulation of actin cytoskeleton
gga05132  Salmonella infection
gga05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    396526 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    396526 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396526 (ACTB)
   04520 Adherens junction
    396526 (ACTB)
   04530 Tight junction
    396526 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396526 (ACTB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    396526 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396526 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    396526 (ACTB)
   03019 Messenger RNA biogenesis [BR:gga03019]
    396526 (ACTB)
   03036 Chromosome and associated proteins [BR:gga03036]
    396526 (ACTB)
   03029 Mitochondrial biogenesis [BR:gga03029]
    396526 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    396526 (ACTB)
   04147 Exosome [BR:gga04147]
    396526 (ACTB)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     396526 (ACTB)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     396526 (ACTB)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     396526 (ACTB)
    NuA4 complex
     396526 (ACTB)
  Chromatin remodeling factors
   BAF complex
    396526 (ACTB)
   PBAF complex
    396526 (ACTB)
   SWR1 complex
    396526 (ACTB)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    396526 (ACTB)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     396526 (ACTB)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   396526 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 396526
NCBI-ProteinID: NP_990849
CGNC: 49855
Ensembl: ENSGALG00000009621
UniProt: P60706
Structure
PDB: 
3J0S

Position
14
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgatgatattgctgcgctcgttgttgacaatggctccggtatgtgcaaggccggt
ttcgccggggacgatgccccccgtgctgtgttcccatctatcgtgggtcgccccagacat
cagggtgtgatggttggtatgggccagaaagacagctacgttggtgatgaagcccagagc
aaaagaggtatcctgaccctgaagtaccccattgaacacggtattgtcaccaactgggat
gatatggagaagatctggcaccacactttctacaatgagctgagagtagcccctgaggag
caccctgtgctgctcacagaggctcccctgaaccccaaagccaacagagagaagatgaca
cagatcatgtttgagaccttcaacaccccagccatgtatgtagccatccaggctgtgctg
tccctgtatgcctctggtcgtaccactggtattgtgatggactctggtgatggtgttacc
cacactgtgcccatctatgaaggctacgccctcccccatgccatcctccgtctggatctg
gctggccgtgacctgacggactacctcatgaagatcctgacagagagaggctacagcttc
accaccacagccgagagagaaattgtgcgtgacatcaaggagaagctgtgctacgtcgca
ctggatttcgagcaggagatggccacagctgcctctagctcttccctggagaagagctat
gaactccctgatggtcaggtcatcaccattggcaatgagaggttcaggtgccccgaggcc
ctcttccagccatctttcttgggtatggagtcctgtggtatccatgaaactaccttcaac
tccatcatgaagtgtgatgtggatatccgtaaggatctgtatgccaacacagtgctgtct
ggtggtaccacaatgtaccctggcattgctgacaggatgcagaaggagatcacagccctg
gcacctagcacaatgaaaatcaagatcattgccccacctgagcgcaagtactctgtctgg
attggaggctctatcctggcctccctgtccaccttccagcagatgtggatcagcaagcag
gagtacgatgaatccggaccctccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system