KEGG   Gallus gallus (chicken): 396530
Entry
396530            CDS       T01006                                 

Gene name
ATP1A1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1 precursor
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396530 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    396530 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396530 (ATP1A1)
Enzymes [BR:gga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     396530 (ATP1A1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   396530 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   396530 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   396530 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   396530 (ATP1A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 396530
NCBI-ProteinID: NP_990852
CGNC: 49857
Ensembl: ENSGALG00000032247
UniProt: P09572
Position
1
AA seq 1021 aa
MGKGAGRDKYEPTATSEHGTKKKKAKERDMDELKKEISMDDHKLSLDELHRKYGTDLSRG
LTTARAAEILARDGPNTLTPPPTTPEWVKFCRQLFGGFSLLLWIGSLLCFLAYGITSVME
GEPNSDNLYLGVVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVVRNGEKMSINA
EGVVVGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDFSNENPLETRNI
AFFSTNCVEGTAVGIVISTGDRTVMGRIASLASGLEGGKTPIAMEIEHFIHLITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVGTLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSATWLALS
RIAGLCNRAVFQANQENVPILKRAVAGDASESALLKCIELCCGSVKEMRERYPKVVEIPF
NSTNKYQLSIHKNANAGESRHLLVMKGAPERILDRCDSILIHGKVQPLDEEIKDAFQNAY
LELGGLGERVLGFCHLALPDDQFPEGFQFDTDEVNFPVEKLCFVGLMSMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISDGNETVEDIAARLNIPVSQVNPRDAKA
CVVHGSDLKDMTSEQLDDILLHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTCTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTD
KLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPSGLVGIRLQWDDRWINDVEDSY
GQQWTFEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFLYDEIRKLIIRRNPGGWVERETY
Y
NT seq 3066 nt   +upstreamnt  +downstreamnt
atggggaagggggctggaagagacaagtatgagcctactgctacatcagaacatggcaca
aagaagaaaaaggcgaaggagagggacatggatgagcttaaaaaagaaatctctatggat
gaccacaagctcagccttgatgaacttcatcgtaaatatggaacagacttgagtcggggt
ttgactactgcacgtgcagctgagattttggctcgtgatggcccaaatacccttacacct
ccacccaccactcctgaatgggtcaagttctgtcggcagctctttggaggattctcactc
ctgttgtggatcggttcccttctgtgttttctggcttatggcattacaagtgtgatggag
ggagagccaaatagtgataacctgtacctaggtgttgtgttggcagctgtggttatcatt
actggctgtttctcatattaccaagaagcgaagagttcgaagatcatggagtcgttcaag
aacatggtgcctcagcaagctcttgtagtcagaaatggtgagaagatgagcataaatgct
gaaggtgttgtagttggagatctggtagaggtgaaaggaggagacagaattccagctgat
ctccggatcatatctgcacatggttgcaaggtggataactcctcgcttactggtgagtca
gagcctcagaccaggtctccagatttctccaatgagaacccactggaaactaggaacatt
gccttcttttccaccaactgtgtggaaggcactgccgtgggcattgttattagcactgga
gaccgcactgtgatgggccgtattgccagtctggcatctggactggaagggggtaagact
cccattgccatggagattgagcactttatccacctcatcactggagtagctgtgttcctt
ggtgtcagcttcttcatcctttcacttatccttgagtacacttggctggaggctgtcatc
ttcctcattgggatcattgtggccaatgtacctgagggattgctcgcaactgtaacggta
tgtctgacactaacagccaagcgtatggctcgtaagaactgcttggtgaagaacctggaa
gctgtgggaactctaggctccacatccaccatctgttctgacaaaacaggcaccctgaca
caaaatcgcatgacagttgcacacatgtggtttgacaatcagattcatgaggctgacact
acagagaaccagagtggtgcttcctttgacaagagctcagctacttggctggctttgtct
agaattgcaggtctctgcaaccgtgctgtgtttcaggccaaccaggaaaacgtaccaatc
cttaagagagcagtagcaggagatgcctctgaatctgcacttctgaaatgcattgaactg
tgctgtggttctgtgaaagaaatgagagaaaggtatcccaaagtggtcgaaataccattt
aactctaccaataagtaccagctgtctatccacaagaatgcaaatgcaggagaatctcgt
cacttgctggtgatgaagggagctccagagaggatcttggatcgctgcgacagcattctt
attcatgggaaagtgcaacccttggatgaggaaattaaagatgcttttcagaatgcctac
ctagagctggggggtcttggggagagagtactgggattctgtcacttggctctgcctgat
gaccagttccctgaaggcttccagtttgacacagacgaagtaaactttcctgtagaaaaa
ctctgctttgtaggattgatgtctatgattgaccctcctcgtgctgctgtgccggatgct
gttggcaaatgcaggagtgctgggattaaggttatcatggttactggagaccatccgatc
acagccaaagccattgccaagggagttggcatcatctctgacggcaacgaaacagtggaa
gatattgctgctcgactcaacattcctgtcagccaggtcaacccgagggatgctaaggca
tgtgttgttcatggctctgatttaaaagacatgactagtgagcaactggatgacatcctg
cttcaccatacagaaatagtctttgccaggacatctcctcagcagaagcttataattgtg
gaaggctgtcagcgccagggtgccattgtagcagtcacaggtgatggtgtgaatgattcc
ccagccctgaagaaggcagacattggtgttgctatgggtattgctgggtcagatgtctcc
aagcaagcagctgacatgattctgctggatgataactttgcctctattgtcactggggtt
gaagaagggcgcctgatctttgataacctgaagaagtcgattgcttacaccttgaccagt
aacattcctgaaatcacacctttcctgatcttcatcattgcaaacatacctctcccactg
ggaacatgcaccatcctctgcattgacttgggcactgacatggtccctgctatctccctg
gcatatgagcaagcagagagtgacatcatgaagaggcagccaagaaatcccaaaacagac
aagctggtgaatgagaggctgatcagcatggcctatgggcagattggtatgatccaggcc
cttggaggtttcttcacctattttgtaatcatggcagagaatgggttcttgccttctggg
ctagtagggattagacttcagtgggatgaccgatggattaatgatgttgaagacagctat
ggacagcaatggaccttcgaacagaggaaaattgtggaattcacttgccatacagccttc
tttgtcagcattgtggttgtgcagtgggcagacttgattatttgtaagacccgaagaaac
tctgttttccagcaggggatgaagaacaagatcctaatatttggtctcttcgaggagact
gctctagctgcattcctgtcctactgccctgggatggatgttgctctaaggatgtacccc
ctcaagccaacctggtggttctgtgccttcccgtactccctcctcatattcctctatgat
gaaatcagaaagctcattatcagacgcaaccctggtggttgggtggaaagagagacctac
tactaa

DBGET integrated database retrieval system