KEGG   Gallus gallus (chicken): 396536
Entry
396536            CDS       T01006                                 

Gene name
APOA1
Definition
(RefSeq) apolipoprotein A-I preproprotein
  KO
K08757  apolipoprotein A-I
Organism
gga  Gallus gallus (chicken)
Pathway
gga03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    396536 (APOA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396536 (APOA1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   396536 (APOA1)
SSDB
Motif
Pfam: Apolipoprotein YtxH DUF5856 ApoLp-III Baculo_PEP_C DUF4455 DUF948 DUF4456 ApoA-II Exonuc_VII_L DUF1978 4HB_MCP_1 Prominin PIN_8 DUF4015 ApoO BORCS6 Atypical_Card DUF2959 DUF445 Lant_dehydr_C Erp_C Atg14 Gp58 ALS2CR8 DUF5660 LMP Thioredoxin_8 OmpH FlgN hnRNP_Q_AcD DUF2937 DUF2884 DUF3150 His_Phos_1 DUF1451 PGK Peptidase_S46
Other DBs
NCBI-GeneID: 396536
NCBI-ProteinID: NP_990856
CGNC: 49860
Ensembl: ENSGALG00000007114
UniProt: P08250
Position
24
AA seq 264 aa
MRGVLVTLAVLFLTGTQARSFWQHDEPQTPLDRIRDMVDVYLETVKASGKDAIAQFESSA
VGKQLDLKLADNLDTLSAAAAKLREDMAPYYKEVREMWLKDTEALRAELTKDLEEVKEKI
RPFLDQFSAKWTEELEQYRQRLTPVAQELKELTKQKVELMQAKLTPVAEEARDRLRGHVE
ELRKNLAPYSDELRQKLSQKLEEIREKGIPQASEYQAKVMEQLSNLREKMTPLVQEFRER
LTPYAENLKNRLISFLDELQKSVA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagaggcgtgctggtgaccctcgctgtgctcttcctgacgggcacccaggcccgctcc
ttctggcagcacgatgagccccagacgcccctggaccgcattcgggatatggtggacgtc
tacctggagacggtgaaggccagcggcaaggatgccatcgcccagttcgagtcctctgct
gtgggcaaacagcttgacctgaagctggctgacaacctggacacgctgagtgccgcggct
gccaagctgcgtgaggacatggctccctactacaaggaggtgcgcgagatgtggctgaag
gacaccgaggctctgcgtgctgagctcaccaaggacctggaggaggtgaaggagaagatc
cggcccttcctggaccagttctccgccaagtggacggaggagctggagcagtaccgccag
cgcctgacgcccgtggctcaggagctgaaggagctcaccaagcagaaggtggagctgatg
caggccaagctgaccccggtggctgaggaggcgcgggatcgtctgcgtgggcacgtggag
gagctgcgcaagaacctggcgccatacagcgatgagctgcggcagaagctgagccagaag
ctggaggagatccgtgagaagggcatcccccaggcttccgagtaccaggccaaggtgatg
gagcagctcagcaacctgcgtgagaagatgacgcctctggtgcaggaattcagggagcgc
ctcaccccctatgctgagaacctcaagaaccgcttgatctccttcctggacgaactccag
aagtccgtggcctga

DBGET integrated database retrieval system