KEGG   Gallus gallus (chicken): 396543Help
Entry
396543            CDS       T01006                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8c precursor
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    396543 (WNT8A)
   04150 mTOR signaling pathway
    396543 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    396543 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    396543 (WNT8A)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Morphogens
   396543 (WNT8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 396543
NCBI-ProteinID: NP_990862
CGNC: 4563
Ensembl: ENSGALG00000037494
UniProt: P51030
Position
13
AA seq 357 aa AA seqDB search
MRGSTFLLLSIVGIYGAILNAAAWSVNNFLMTGPKAYLTYSSSVAAGAQSGMEECKFQFG
WERWNCPESALQLSTHNRLRSATRETSFVHAISSAGVMYTLTRNCSLGDFESCGCDDSRN
GRVGGRGWVWGGCSDNVEFGERISKLFVDALETGHDTRALINLHNNEVGRLAVKATMKRA
CKCHGVSGSCSIQTCWLQLADFREIGNYLKMKYDQAHKLEMDKRRMRAGNSADSRGATAE
TFHHVHSTELVFLEDSPDYCTRNASLGHHGTEGRECLQTGKNLSQWERRSCRRLSTECGL
KVEERRTEVVSSCNCKFHWCCTVRCEQCRQLVAKHFCARRDAAVANHTKRRNKGHRR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcagcaccttcctcctcctctccatcgtgggcatctacggtgctattctcaat
gcagcagcatggtcggtgaataactttctgatgacaggacctaaggcgtacctgacgtac
tccagcagcgtggcggcgggcgcacagagtgggatggaggagtgcaagttccagttcgga
tgggagcgctggaactgccccgagagcgccctgcagctctccacccacaaccgcctgcgc
agtgctaccagagagacatcctttgtgcacgccatcagctccgctggtgttatgtacacc
ctgaccaggaactgcagcttaggagacttcgagagctgcggctgtgatgactccaggaac
gggcgtgtaggtggccgaggctgggtctggggaggctgcagcgacaacgtggagtttggg
gagaggatttccaagctctttgtggatgctttggaaacaggacacgatacccgtgccctg
atcaacctgcacaacaacgaagtcgggagacttgctgtgaaagccacgatgaagcgagcc
tgcaagtgccatggggtgtcaggcagttgcagcatccagacatgctggctccagctcgct
gactttcgggagattggcaactacctgaagatgaaatacgaccaagcgcataagctggag
atggacaagaggcggatgagagctggcaacagcgccgacagccgcggcgccactgctgag
accttccaccacgtccactccacggagctcgtctttttggaggactcccccgactactgc
acgaggaacgccagcctgggccaccacggcaccgagggccgcgagtgcctacagaccggc
aagaacctctctcagtgggagcggaggagctgccggcggctctcgacggagtgcggcctc
aaagtggaggagaggaggacagaggtggtcagcagctgcaactgcaagttccactggtgc
tgcacggtgcggtgcgagcagtgccggcagctggtggccaagcacttctgtgcccgccgc
gatgccgccgttgccaaccacaccaagcggcggaacaaaggccacaggagatag

DBGET integrated database retrieval system