KEGG   Gallus gallus (chicken): 396548Help
Entry
396548            CDS       T01006                                 

Gene name
COL6A3
Definition
(RefSeq) collagen alpha-3(VI) chain precursor
  KO
K06238  collagen, type VI, alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    396548 (COL6A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396548 (COL6A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396548 (COL6A3)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    396548 (COL6A3)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396548 (COL6A3)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   396548 (COL6A3)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   396548 (COL6A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA VWA_2 Collagen VWA_3 Kunitz_BPTI fn3
Motif
Other DBs
NCBI-GeneID: 396548
NCBI-ProteinID: NP_990865
CGNC: 2875
Ensembl: ENSGALG00000003923
UniProt: F1P2F0
Position
7
AA seq 3137 aa AA seqDB search
MRKHRHLPLAAILGLLLSGFCSVGAQQQAAVRNVAVADIIFLVDSSWSIGKEHFQLVREF
LYDVVKALDVGGNDFRFALVQFSGNPHTEFQLNTYPSNQDVLSHIANMPYMGGGSKTGKG
LEYLIENHLTKAAGSRASEGVPQVIIVLTDGQSQDDVALPSSVLKSAHVNMIAVGVQDAV
EGELKEIASRPFDTHLFNLENFTALHGIVGDLVASVRTSMTPEQAGAKGLVKDITAQESA
DLIFLIDGSDNIGSVNFQAIRDFLVNLIESLRVGAQQIHIGVVQYSDQPRTEFALNSYST
KADVLDAVKALSFRGGKEANTGAALEYVVENLFTQAGGSRIEEAVPQILVLISGGESSDD
IREGLLAVKQASIFSFSIGVLNADSAELQQIATDGSFAFTALDIRNLAALRELLLPNIVG
VAQRLILLEAPTIVTEVIEVNKKDIVFLIDGSTALGTGPFNSIRDFVAKIVQRLEVGPDL
IQVAVAQYADTVRPEFYFNTHQNRKDVMANVKKMKLMGGTALNTGSALDFVRNNFFTSAA
GCRMEEGVLPMLVLITGGKSMDAVEQAAAEMKRNRIVILAVGSRNADVAELQEIAHERDF
VFQPNDFRLQFMQAILPEVLSPIRTLSGGMVIHETPSVQVTKRDIIFLLDGSLNVGNANF
PFVRDFVVTLVNYLDVGTDKIRVGLVQFSDTPKTEFSLYSYQTKSDIIQRLGQLRPKGGS
VLNTGSALNFVLSNHFTEAGGSRINEQVPQVLVLVTAGRSADPFLQVSNDLARAGVLTFA
VGVRNADKAELEQIAFNPKMVYFMDDFSDLTTLPQELKKPITTYVSGGVEEVPLAPTESK
KDILFLIDGSANLLGSFPAVRDFIHKVISDLNVGPDATRVAVAQFSDNIQIEFDFAELPS
KQDMLLKVKRMRLKTGKQLNIGVALDEVMRRLFVKEAGSRIEEGIPQFLVLLAAGRSTDE
VERPSGALKEAGVVTFAIKAKNADLSELERIAYAPQFILNVESLPRISELQANIVNLLKT
IQFQPTVVERGEKKDVVFLIDGSDGVRRGFPLLKTFVERVVESLDIGRDKVRVAIVQYSN
AIQPEFLLDAYEDKADLVSAIQALTIMGGSPLNTGAALDYLIKNVFTVSSGSRIAEGVPQ
FLILLTADRSQDDVRRPSVVLKTSGTVPFGIGIGNADLTELQTISFLPDFAISVPDFSQL
DSVQQAVSNRVIRLTKKEIESLAPDLVFTSPSPVGVKRDVVFLVDGSRYAAQEFYLIRDL
IERIVNNLDVGFDTTRISVVQFSEHPHVEFLLNAHSTKDEVQGAVRRLRPRGGQQVNVGE
ALEFVAKTIFTRPSGSRIEEGVPQFLVILSSRKSDDDLEFPSVQVKQVGVAPMVIAKNMD
PEEMVQISLSPDYVFQVSSFQELPSLEQKLLAPIETLTADQIRQLLGDVTTIPDVSGEEK
DVVFLIDSSDSVRSDGLAHIRDFISRIVQQLDVGPNKVRIGVVQFSNNVFPEFYLRTHKS
KNAVLQAIRRLRLRGGYPVNAGKALDYVVKNYFIKSAGSRIEDGVPQHLVVILGDQSQDD
VNRPANVISSTSIQPLGVGARNVDRNQLQVITNDPGRVLVVQDFTGLPTLERKVQNILEE
LTVPTTEGPVYPGPEGKKQADIVFLLDGSINLGRDNFQEVLQFVYSIVDAIYEDGDSIQV
GLAQYNSDVTDEFFLKDYSSKPEILDAINKVIYKGGRVANTGAAIKHLQAKHFVKEAGSR
IDQRVPQIAFIITGGKSSDDGQGASMEVAQKGVKVFAVGVRNIDLEEVSKLASESATSFR
VSTAQELSELNEQVLVTLAAAMKEKLCPGTTDVTRDCDLDVILGFDVSDVGAGQNIFNSQ
RGLESRVEAVLNRITQMQKISCTGSRAPSVRVAIMAQSRGGPVEGLDFSEYQPELFERFQ
GMRTRGPYFLTAETLKSYQNKFRSAPSGSTKVVIHFTDGTDDYLDQMKTASADLRRQGVH
ALLFVGLDRVKNFEEVMQLEFGRGFTYNRPLRVNLLDLDFELAEQLDNIAERTCCGVPCK
CSGQRGDRGLPGPIGPKGATGEIGYGGYPGDEGGPGERGPPGVNGTQGFQGCPGHRGTKG
SRGFPGEKGELGEMGLDGIDGEEGDKGLPGSSGEKGFSGRRGSKGAKGERGERGDRGLRG
DPGESGADNTQRGTRGQKGEIGQMGEPGPAGQRGQDGGVGRKGMAGRRGPIGVKGTKGAL
GQPGPAGEQGMRGPQGPPGQIGTPGIRGEQGIPGPRAGGGQPGAPGERGRIGPLGRKGEP
GNPGPRGPNGQQGPRGEMGDDGRDGIGGPGPKGRKGERGFVGYPGPKGGPGDRGGAGGPG
PKGNRGRRGNAGNPGTPGQKGEIGYPGPSGLKGDKGPSISQCALVQNIKDKCPCCYGPKE
CPVFPTELAFAIDTSSGVGRDVFNRMKQTVLRVVSNLTIAESNCPRGARVALVTYNNEVT
TEIRFADARKKSSLLQQIQNFQATLTTKPRSLETAMSFVARNTFKRARSGFLMRKVAVFF
SNGETRASPQLNDAVLKLYDAGVTPVFLTSRQDAVLERALEINNTAVGHAIILPTSGSQL
NDTIRRLLTCHVCLDVCEPDPICGYGSQRPVFRDRRAAPTDVDTDIAFIMDSSASTTPLQ
FNEMKKYISHLVSNMEISSEPKISQHHARVAVLQQAPYDHETNSSFPPVKTEFSLTDYGS
KEKIINYLHNQMTQLYGTMAMGSAVEHTVAHVFESAPNPRDLKVIVLMITGKMEKQELEY
LREAVIDAKCKGYLFVILGIGKNVDVKNIYSLASEPNDVFFKLVSKPGELHEEPLLRFGR
LLPSFIRSDFAFYLSPEIRKQCKWLQADQTPKSPGHTGQKAVYIAPNGTVTQTISTTTTL
STTFKPAASTSAHAKTTTASTTAQTRATERPTESTTVQVNATVQSQGSTAANTKATSRTT
TSTTAAAASGRRRQGAKMNDIQITDVTENSARLRWASPEPHNAYVFDLAITLAHDHSLVL
KQNVTGTERVIGGLRSGQKYLVFITGYLKSQPKVTYTGTFSTKTPAQPKVALANMMLNAE
PLEGPENVMDICLLQKEEGTCRDFVLKWHYDLKTKSCARFWYGGCGGNENRFNTQKECEK
ACSPGNISPGVVTTIGT
NT seq 9414 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcatcggcatttgccccttgcggcaatacttggcctcctgctctcaggcttt
tgctcagtgggtgcccagcagcaagcagctgtcagaaacgttgccgtggctgatataata
tttctagtggattcctcttggagcattgggaaggagcacttccaactcgttcgagagttt
ctgtatgatgttgtaaaggctttagatgtgggaggaaatgatttccgttttgcactggtc
cagttcagcggaaacccacacacagagttccagttaaatacgtacccctctaaccaagat
gtgctctcccatatcgcgaatatgccttacatggggggaggcagcaagactggaaaagga
ttagagtacctaatcgagaaccatctcactaaagctgctggaagcagagcgagtgaaggc
gtcccccaggttattatagtgttaacggacggacaatcccaggatgatgtggctctgcca
tcatctgtccttaaatcggcccatgtaaacatgattgcggtcggcgtgcaggatgcggtg
gaaggggagttaaaggagatagcgagccgacccttcgatacccaccttttcaacctagag
aattttaccgctctccatggcatagttggagacttagtggcaagtgtccgtacctccatg
actccagaacaggctggagccaaaggactggttaaagacatcacagctcaagagtctgct
gaccttattttccttattgacggatcagacaacatcggaagtgtcaattttcaagccata
cgcgatttccttgtaaatttgattgaaagcctcagagttggagctcagcagatacacatt
ggggtggtgcagtatagtgatcaacccagaactgagttcgctttgaacagctactccaca
aaagcggatgttctggatgccgtgaaggcactcagtttccgcggtggcaaggaagctaac
actggtgcagcactggagtatgtggtggagaacctcttcacccaggcaggaggcagcagg
atagaggaagcggtgcctcagatcttagtgctgataagtggtggagagtctagcgatgat
atccgagagggcttgttagcggtgaagcaagctagtatattttcatttagcattggggtc
ctgaatgctgacagtgcagagctgcagcagattgctactgatggaagcttcgcatttact
gccctggatatccgtaaccttgctgctcttcgagaattattactgcccaacattgttgga
gtggcccaaagactcattttgttagaggccccaaccattgtgactgaagttattgaagtg
aacaagaaggatatagtcttcctgatagatggctcaacagctctggggactggccccttt
aactcaattcgtgatttcgttgccaaaatcgtccaaaggctggaggttggacctgacctg
atccaagttgcggtggctcagtatgcagacactgtgaggccagagttttattttaacacc
catcagaacagaaaggatgtgatggctaatgtgaagaaaatgaagctcatgggcggtacg
gccctcaacactggctcggcactggactttgtgaggaacaacttcttcaccagtgctgcc
gggtgtaggatggaggaaggggtgctccccatgctggtactcatcactggtggtaagtcc
atggatgccgttgagcaagctgcagcagagatgaaaaggaacaggatagtgatccttgct
gttgggtcgagaaatgctgacgtggcagaactccaagaaattgctcatgagagagatttt
gtgttccaaccaaatgatttccgccttcagttcatgcaagccattcttcctgaggtgctg
tcacccatccggacactctccggaggaatggtcatccacgaaacaccatcagttcaagta
accaaaagggatatcatctttcttttggatggatcactcaacgtcggaaatgccaacttc
ccctttgtgcgggactttgttgtgactttagttaactaccttgatgtcggaaccgacaaa
atccgagttggcttagtgcaatttagcgacactcctaaaaccgagttctccctatactca
taccaaaccaaatcagacataattcaacgtttggggcagctgaggcccaagggtgggtca
gtgctgaacaccggctctgcactgaactttgtgctttcgaatcacttcactgaagctggt
gggagcagaataaatgaacaagtgccgcaggtcctagtcctggtgacggcagggaggtcg
gccgatcccttcctgcaagtttccaatgacttagctcgggccggagtgctgacttttgct
gttggagttaggaatgcggataaggcagagcttgaacagattgcatttaatccaaaaatg
gtatattttatggatgatttcagtgatctgacaacattacctcaggagttaaaaaagcct
ataacaacatatgttagtggaggtgtggaggaggttccactcgccccaacagaaagcaag
aaagacattttattcctgattgatggttcagccaacctcttgggtagctttcctgctgtc
cgggactttatacacaaagtcatttctgacctgaacgtgggtcccgacgccacgcgagta
gctgtggctcagttcagtgacaacatccaaattgaatttgactttgctgaactcccatct
aagcaagacatgcttctgaaagtgaaaaggatgaggttaaaaactgggaagcagctgaat
atcggagttgcgctcgatgaagtcatgaggaggctgttcgtgaaggaagctggaagcagg
attgaagaaggcattcctcagttcttggtcctcctggctgctgggaggtcaaccgatgag
gtggagcgaccatcgggagctctgaaggaagctggagttgtgacctttgctatcaaagcc
aaaaatgctgatttatcagagctggaaaggatagcttacgccccacagttcattctgaat
gtcgaatcccttcctcggatttcggagctccaggcaaacatagtgaacctactgaaaact
atccagtttcagccaacagtagttgagagaggtgagaagaaggatgtggtgtttctaatc
gatggctcggatggtgtcagaagaggtttccctctcctgaaaacctttgtggaaagagtt
gttgaaagccttgatattggccgtgacaaggtccgtgttgccattgtgcagtacagcaac
gccatacaacctgagttcttgctggatgcctacgaagacaaagccgatttagtcagtgcc
atccaggcgctgacaattatgggaggatctcctctgaacaccggagcagccctcgactat
ctcatcaagaacgtgttcaccgtgtcgagtggcagcaggatagctgagggcgtcccgcag
ttcctgatcctgctcactgccgaccgatcccaggatgatgtgaggaggccctcagtggtc
ctcaagacgagtggcacagtgcccttcggcatcgggattggaaatgccgacctcacagag
cttcagacgatctccttcctcccggattttgctatctctgtacccgacttcagccagctg
gattcagtgcaacaggccgtgtccaacagagtcatccggctgaccaagaaagaaatagag
tctcttgcccctgatctggtttttacatcacccagcccagtgggtgtgaagagggatgtt
gtgttcctggtcgatggctcccgctacgccgcccaggaattctacctcatccgtgatctc
attgagaggatagtgaacaacctggatgtgggctttgacaccactcggatttcggtggtc
cagttcagcgagcatccccatgtagagtttcttctcaatgcccactccaccaaggatgag
gtgcaaggtgcagtgaggcggctgcggccacggggtggccagcaggtgaacgtgggggaa
gcccttgaatttgtggcaaaaaccatctttacccgtccgtctgggagccgcatagaagag
ggcgtccctcagtttttggttatcctctcctcccgcaagtccgacgatgacttagaattc
ccatcggtacaagtcaaacaagtaggagtggcacctatggtcatagcaaagaacatggat
cctgaggagatggtgcagatttcccttagccctgactatgtgttccaagtctccagcttc
caggaactgcccagccttgaacagaagctgctggctcctattgaaaccctgactgcagac
caaatcagacaactcctgggagatgtgacaacaattccagatgtttctggtgaggaaaag
gacgtagtcttccttattgatagctccgacagcgttaggtctgatgggcttgctcacatt
cgggatttcatcagcagaattgtccagcagcttgatgttgggccaaacaaagtgcggatt
ggagtggtgcaattcagcaataatgtcttccctgagttctacttgagaacccacaagtct
aagaatgccgtactgcaagccatccgccgcttacggcttagaggagggtaccccgtgaac
gctggcaaagccctggactacgtggtgaagaactacttcatcaagtctgcagggagcagg
atagaagatggagtgccccagcatctagttgtcatccttggagatcagtcccaggatgat
gtcaacaggcctgctaatgtgatctcttcaacgagtattcaacctctgggtgtaggagcc
aggaatgtagacaggaaccagctgcaggtcatcaccaatgatcctggccgcgtgcttgta
gtgcaggacttcacaggactgcccactttagaaagaaaggtgcagaacattcttgaagag
cttacagtacctacaacagaaggccctgtatatccaggaccagaaggcaagaagcaggct
gacattgtgtttttgctggatggctccatcaacctgggaagagataacttccaagaggtt
ctccagttcgtgtattctatagtggatgccatctatgaggatggtgactccatccaggta
ggactggcacagtacaactctgatgtcactgatgagtttttcctcaaggattactccagc
aaacctgagattttagacgccatcaacaaggtgatctacaaaggtggccgagtggcaaac
actggtgcagccatcaagcaccttcaggcaaaacactttgtgaaggaggctggcagccga
attgaccagagggtgcctcagatcgccttcatcatcacaggggggaaatcttccgatgat
gggcaaggtgcctccatggaagttgcacagaagggtgtcaaggtgtttgcagttggtgta
aggaacatcgacctggaggaggtcagcaagttggccagcgagagtgccacgagtttcaga
gtgtcgacggctcaggagttgtctgaactgaatgagcaggtcttggttacattggcagct
gctatgaaggagaaactgtgcccaggaacgacagatgtgacaagggactgcgacttagac
gtgatacttggcttcgatgtgtcagatgtcggagccggccaaaacatcttcaattcccag
agagggctggagtccagggtcgaggctgtgctgaacaggataacacagatgcagaagatc
agctgtaccggcagccgggcgcccagtgtcagagtggccatcatggcccagtcccggggg
ggacccgtggagggattggacttttctgagtaccagcctgagctctttgagaggttccaa
ggcatgcgcacccgtgggccctatttcctcacagccgagacactgaaatcctaccagaac
aagttcagatcagcaccctctggcagcacgaaggtggtaatccattttacagatggtaca
gatgactacttggatcagatgaagactgcctcggctgatttgcgtagacaaggtgtccat
gctctcctcttcgttggcttggatcgagtgaaaaactttgaggaagtgatgcagctggag
ttcgggaggggtttcacctacaacaggccgctgagagttaatctcctggacttggatttc
gagttggcagagcagctcgataacatcgcagaaaggacgtgctgtggggtcccttgcaag
tgctcagggcagagaggggacagaggtcttcccggccccataggaccaaagggtgctaca
ggtgagattggctacggaggctatcctggcgatgaaggaggaccgggtgagcgtggacct
ccaggagtgaatgggacgcagggcttccagggatgccctgggcacagaggaaccaagggt
tctcggggattcccaggagagaagggcgaactgggagaaatgggtctggatggcattgat
ggagaagagggagacaaaggcttgcctggttcctccggagagaaggggttctctggcagg
aggggtagtaaaggagccaaaggtgaacgaggagagcgaggtgaccgtgggctccgtgga
gaccccggagagtcgggagcagataatactcagcggggaaccagaggccaaaagggtgaa
atcggacaaatgggagagcctggacctgcggggcagagaggccaagatggaggagttggg
aggaagggcatggcgggacgcagggggccaataggagtcaagggtaccaagggcgcgctt
ggccagccagggccagctggagaacaaggcatgagaggaccacagggcccacctggccag
attggcactccaggcatcaggggagagcaaggcatccctgggcccagggctggtggtggg
caaccaggagcacctggagaaaggggcaggattggcccactgggacgaaagggtgagcct
ggaaatcctggacccaggggaccgaatggacagcaaggcccacgaggagagatgggtgat
gatggacgagatggaattggtggcccaggtcctaaaggcagaaagggagaacgtggcttt
gttggctacccaggacccaagggtggacctggtgaccgtggtggtgctggaggccccgga
cctaaaggaaacagaggccgtagaggaaacgctggaaatcctggcacacctggtcagaaa
ggagagattggataccccggaccatctggacttaaaggtgataaaggaccatccatcagt
caatgtgctctcgtgcagaacatcaaagataaatgcccttgctgctatggtcccaaggag
tgccctgtcttcccaaccgagctggccttcgctattgacacctcctcaggtgtcgggagg
gatgtcttcaacaggatgaaacaaaccgtgctcagggtggtcagcaacttaaccattgct
gagagcaactgccctcgtggtgcccgcgtggccctggtcacctacaacaatgaggtcacc
acagagatccgctttgctgatgccaggaagaaatcaagcctcctccagcagatccaaaac
ttccaggcaaccctgaccacaaagccacgcagcctggagactgccatgtcctttgtggcc
aggaacaccttcaagcgtgcccgaagtgggttcctcatgaggaaggtggctgtctttttc
agcaacggggagacgagagcctccccgcagctcaacgatgccgtgctgaagctctatgac
gctggggtcactcctgtgttcctcaccagcaggcaggatgcagttctcgaaagagctctg
gagatcaacaacacagcagttggacatgcaatcattcttccaaccagcggcagccagctg
aatgacactatccggaggctcttgacttgtcatgtttgtctggatgtgtgtgaacctgat
cccatctgcggttacggcagtcaaagacctgtattcagagacagaagggcagccccgaca
gatgtggacactgacatagccttcatcatggatagctcggcctccaccacacctctgcag
ttcaacgagatgaagaagtacatttcccacctcgtaagcaacatggaaatcagctctgag
ccaaaaatatctcagcaccacgcgagagtggcagtcctccagcaagctccttatgatcat
gaaaccaactcaagcttcccaccagtgaaaacagagttttcattaaccgattacggatcc
aaagagaagatcatcaattacttgcacaaccaaatgacgcagctctatggcacaatggcc
atgggaagcgcagttgaacacacagtggctcatgtttttgaaagtgcaccaaaccctcgg
gatctcaaagtcatcgttctcatgataactgggaaaatggagaaacaagagctggagtac
ttgcgggaggctgtaattgatgcaaaatgcaaaggatacttgttcgttatcttgggcatt
ggcaagaacgtggatgtcaagaatatctacagcctagctagtgagccaaatgacgtgttc
ttcaaattggtctctaagcctggagagcttcatgaagaacccctgctacgctttgggaga
ctgctgccatcttttatcagaagtgactttgctttctacctatctccagaaataaggaaa
cagtgcaagtggctccaggctgatcaaacacccaagagccctgggcacactggacaaaaa
gcagtatatatagcccccaatggaaccgtaacccaaaccataagcaccaccaccacacta
agcaccaccttcaagcctgctgcaagcaccagtgcccatgccaagaccaccactgccagc
accacggcccaaaccagagccacggagaggcccacagagagcactactgtccaggtgaat
gctactgtacagagccaaggaagcactgctgccaacaccaaagccaccagccgcaccaca
acgagcaccacagctgcagcagcaagcggcaggagaagacaaggtgcaaagatgaatgac
atccagatcacagatgtcaccgagaacagcgccaggctgcgctgggccagccctgagcca
cacaacgcctacgtgtttgatcttgccatcaccttagcacacgaccactctcttgtgctg
aagcaaaacgtaaccggcaccgaacgtgtcattgggggcctcagaagtggacagaaatac
ctcgtcttcattaccggctacctgaaatcccagcccaaagtgacctacacggggacattc
agcacaaagaccccagcgcagcccaaagtggctctggccaacatgatgctgaacgctgag
ccactggaagggcctgaaaatgtcatggacatctgcctgctgcagaaggaggaggggacc
tgcagggactttgtgctcaagtggcactacgacctgaagaccaagagctgtgccaggttc
tggtacggcggctgcggaggcaacgagaacagattcaacacgcagaaagaatgcgaaaaa
gcctgcagccctggtaacatcagccctggcgtggtgacgacgataggaacatag

DBGET integrated database retrieval system