KEGG   Gallus gallus (chicken): 404271
Entry
404271            CDS       T01006                                 

Gene name
ANXA1
Definition
(RefSeq) annexin A1
  KO
K17091  annexin A1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    404271 (ANXA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    404271 (ANXA1)
Membrane trafficking [BR:gga04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    404271 (ANXA1)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   404271 (ANXA1)
SSDB
Motif
Pfam: Annexin GT-D
Other DBs
NCBI-GeneID: 404271
NCBI-ProteinID: NP_996789
CGNC: 11272
Ensembl: ENSGALG00000015148
UniProt: Q6QAZ9
Position
Z
AA seq 342 aa
MAMVSEFLKQAWFMDNQEQECIKSSKGGSSVQSRPNFDPSADVSALDKAITVKGVDEATI
IDILTKRTNAQRQQIKAAYQQAKGKSLEEDLKKVLKSHLEDVVVALLKTPAQFDAEELRA
SMKGLGTDEDTLIEILASRNNREIREASRYYREVLKKDLTQDIISDTSGDFQKALVILAK
GDRCEDPHVNDDLADNDARALYEAGEKRKGTDVNVFITILTSRSYPHLRRAFQKYAKYSK
HDMNKVLDLELKGDIENCLTALVKCATSKPAFFAEKLHLAMKGSGTRHKQLIRIMVSRHE
IDLNEIKAYYKSLYGISLRQAIMDELKGDYETILVALCGSDK
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggctatggtatcagaatttctgaaacaggcatggttcatggacaaccaggagcaggaa
tgtattaaaagttcaaaaggtggctcttcagtacagtcacgcccaaactttgatccctcg
gctgatgtttctgctttggataaagctattactgtaaagggtgtagatgaagccaccatc
attgacatcttgactaaaagaacaaatgctcaacgtcagcagatcaaagctgcctatcaa
caggcaaaaggaaagagcctggaagaagacttgaaaaaggtgctgaaaagccacttggaa
gatgttgttgttgctcttctcaaaactccagctcagtttgatgctgaagaattaagggcc
tctatgaaggggcttggaactgatgaagatactttaattgagattctggcatcaagaaac
aacagagaaatcagagaagccagtagatactacagagaagtactgaagaaagatctgaca
caagatataatttctgacacgtctggagactttcaaaaggctttggttattctagccaag
ggtgaccgatgtgaagatcctcatgtgaatgatgatcttgctgacaatgatgcaagggcc
ttatatgaagcaggagagaaaaggaaagggacggatgttaacgtgtttattactattctt
acttcaagaagctaccctcatcttcgaagggcctttcagaagtatgctaaatacagcaag
catgacatgaacaaagtacttgatttggagctgaaaggtgatattgaaaactgcctgact
gcccttgtgaagtgcgccacaagcaagccagctttctttgctgaaaaactccacctggca
atgaaggggagtggaacacgacacaaacagctcatcagaatcatggtatcacgccatgaa
atagacttgaatgagatcaaagcttattataagagtctgtatggtatatctcttcgccaa
gcaattatggatgaactcaaaggggattatgaaaccatcctggtcgctttatgtggaagc
gataaataa

DBGET integrated database retrieval system