KEGG   Gallus gallus (chicken): 404529
Entry
404529            CDS       T01006                                 

Gene name
GJA4
Definition
(RefSeq) gap junction alpha-4 protein
  KO
K07613  gap junction alpha-4 protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    404529 (GJA4)
Transporters [BR:gga02000]
 Other transporters
  Pores ion channels [TC:1]
   404529 (GJA4)
SSDB
Motif
Pfam: Connexin Connexin43 KELK
Other DBs
NCBI-GeneID: 404529
NCBI-ProteinID: NP_996867
CGNC: 1818
Ensembl: ENSGALG00000002532
UniProt: F1NJ17
Position
23
AA seq 343 aa
MGDWGFLEKLLDQVQEHSTVIGKIWLTVLFIFRILILGLAGESVWGDEQSDFVCNTKQPG
CTNVCYDKAFPISHIRYWVLQFLFVSTPTLIYLGHVVYLSRKEEKLKQQENELRAIHSKD
PKIEQALAAVEKKMSKIYVTEDGRLKIRGALMWTYVISVICKSIFEAGFLVGQWYLYGFS
MVPRYVCRRDPCPHQVDCFISRPTEKTIFIIFMMVMGLISLILNLLELFHLCCKSLLSSI
KKVPVPVGPSQSAFADDMGSGPYPAKHYPFLPMAESHTPPYQAYNKLSSEQNWANFRNEE
NLALGSGTRPLSDPYAPRAPDAPIPEEKQCSRPSSSASKKQYV
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgggcgactggggattcctggagaaactgctggaccaagtccaggagcactccaccgtg
atcgggaagatctggctcaccgtcctcttcatcttccgtatcctcatcctgggcttggct
ggtgagtccgtgtggggggacgagcagtcggacttcgtgtgcaacaccaagcagccgggc
tgcaccaatgtctgctatgacaaagccttccccatctcccacatccgctactgggtgctg
cagttcctctttgtcagcaccccgaccctcatttacctgggccacgttgtctatctctcg
cggaaagaggagaagctgaaacagcaggagaatgagctccgggctattcacagcaaggac
ccaaagattgagcaagcattggcagctgtagaaaagaagatgtccaagatctacgtgaca
gaagatgggcggctcaagatccgaggggcactgatgtggacgtacgtcatcagtgtgatc
tgcaagagcatctttgaggcaggcttcctcgttggccagtggtacctgtatggcttctcc
atggtgccccgctacgtgtgcaggagggacccctgcccgcaccaggtggactgcttcatc
tcccgccccaccgagaagaccatcttcatcatcttcatgatggtgatgggcctcatttcc
ttaatcctcaacctcctggagctcttccacctctgctgcaagagcctgctcagcagcatc
aagaaggtgccggtgccggttggcccgagccagagtgcctttgctgatgacatgggctcg
ggtccctacccagccaagcattaccccttcctgcccatggctgagagccacacaccgccc
taccaggcttacaacaagctctccagcgagcagaactgggccaacttccgcaacgaggag
aacctggcactgggcagcggcaccaggcccctctcggacccctacgcccccagggctcca
gatgcccccatccctgaggagaagcagtgcagccggcccagcagctcagcatccaagaag
cagtatgtttag

DBGET integrated database retrieval system