KEGG   Gallus gallus (chicken): 404671Help
Entry
404671            CDS       T01006                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta precursor
  KO
K05425  interleukin 12B
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04620  Toll-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga05164  Influenza A
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    404671 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    404671 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    404671 (IL12B)
   04625 C-type lectin receptor signaling pathway
    404671 (IL12B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    404671 (IL12B)
   05168 Herpes simplex virus 1 infection
    404671 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    404671 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    404671 (IL12B)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Interleukins
   404671 (IL12B)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Cytokines
   404671 (IL12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12p40_C Ig_5 Ig_4 Ig_3 Ig_2 LPD29 ig
Motif
Other DBs
NCBI-GeneID: 404671
NCBI-ProteinID: NP_998736
CGNC: 966
Ensembl: ENSGALG00000001409
UniProt: Q6X0K9
Position
13
AA seq 315 aa AA seqDB search
MSHLLFALLSLLSFAALLEAQWKLRENVYVIESEWNDETPAKKVKLTCDTSDEALPVYWK
KGTELKGTGKTLTTEVKEFPDAGNYTCLSAKTHEIISYSFFLITKVDSNGQMIRSILKSY
KEPSKTFLKCEAKNYSGIFTCSWMTENESPSVKFTIRSLKGSQGDVTCSSPVARTDKSVT
EYTAQCQKENYCPFAEEHQPTEMFLEVIDEVEYENYTSSFFIRDIIKPDPPQCQYASTNG
TVTWTYPKTWSTPKSYFPLTFRVKVESTKKYKSKVYDADEQSIQIPKTGPKDKISVQARD
RYYNSSWSEWSTLCR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacctgctatttgccttactttcattactttcctttgctgcccttctggaagca
cagtggaaacttagagagaatgtgtatgtcatagaatctgagtggaacgatgagacacca
gctaaaaaagtgaagctcacctgtgacacatctgatgaagcactgccagtttactggaaa
aagggaacagaactgaaaggaactggaaagactctgaccaccgaagtgaaggagttccca
gatgctggcaactacacctgcctgtctgctaagacccacgagattatcagctacagtttc
tttctcataactaaagtagactccaatgggcaaatgatacggtcaattctgaaaagctat
aaagagccaagcaagacgttcttaaaatgtgaggcaaagaactactctggaattttcaca
tgttcatggatgacagaaaatgagagtccaagtgtgaagttcacaattaggagcctaaaa
ggctctcaaggagatgtaacctgcagcagccctgtggctcgcactgataaatctgtgact
gaatacactgcccagtgccagaaggaaaactactgtccatttgccgaagagcaccagccg
actgagatgttcctggaggtcattgatgaggtggaatatgagaactacactagtagcttc
ttcatcagagatatcataaagccagacccacctcaatgtcagtatgcaagcacaaatgga
actgtgacctggacatatcccaagacctggagcacaccgaagtcctacttccctttgact
ttcagggtcaaagttgaaagcacaaagaaatacaaaagcaaggtttatgatgctgatgag
cagtctattcagattccaaagactgggccaaaagacaagatctctgtgcaggccagggat
cgctattacaactcatcctggagtgagtggtccacgctttgcagataa

KEGG   Gallus gallus (chicken): 407090Help
Entry
407090            CDS       T01006                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha precursor
  KO
K05406  interleukin 12A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04620  Toll-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga05164  Influenza A
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    407090 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    407090 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    407090 (IL12A)
   04625 C-type lectin receptor signaling pathway
    407090 (IL12A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    407090 (IL12A)
   05168 Herpes simplex virus 1 infection
    407090 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    407090 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    407090 (IL12A)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Interleukins
   407090 (IL12A)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Cytokines
   407090 (IL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12 K-cyclin_vir_C
Motif
Other DBs
NCBI-GeneID: 407090
NCBI-ProteinID: NP_998753
CGNC: 7289
Ensembl: ENSGALG00000009574
UniProt: Q6X0L0
Position
9
AA seq 205 aa AA seqDB search
MAEHGIGIGSRAARLGVGRCVLLAALCLLLPSTWALPPPAHNLAKGLNCSRALLAAANEA
LLKVQKQRTLGFECTLEEVDLEDVTNSQSNTIKSCTSQDPGPGNCPVLESSTLDMSKCLQ
GIYEDLKTYKAELGNLKDLRVLTSIDDMMQALQPRSPAMPQPSPSTTLGSFQGRMRLCGV
LHAFCLRAVTIGRMLGYLSALTAEM
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcacggcatcggcatcggcagcagagcggcacggctgggggtcgggcgctgc
gtgctgctggccgcgctctgcctgctgctgccttccacgtgggcactgccacctcctgcc
cacaacctggccaagggactcaactgctccagggcgctgctggccgctgcaaacgaggca
ctcctgaaggtgcagaagcagaggacgctggggtttgagtgcacccttgaagaggtcgat
cttgaagacgtcaccaacagtcagagcaacacaataaagtcctgcacgtctcaggatccg
gggcctggaaactgccccgtactggaaagttctactttagatatgagcaaatgcctgcag
gggatctacgaagacctgaaaacctacaaggcagagctggggaacctcaaggatctgagg
gtgctgacatccattgatgacatgatgcaagccctgcagccccgcagcccagccatgccg
cagccctcgcccagcaccacccttggctccttccagggccgcatgcggctctgcggggtc
ctgcacgccttctgcctgcgcgcagtcaccatcggcaggatgctgggctacctgagtgcc
ctcactgcagagatgtaa

DBGET integrated database retrieval system