KEGG   Gallus gallus (chicken): 404776
Entry
404776            CDS       T01006                                 

Gene name
BLEC1
Definition
(RefSeq) C-type lectin domain family 2 member E
  KO
K10072  C-type lectin domain family 2 member D
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:gga04054]
    404776 (BLEC1)
   04091 Lectins [BR:gga04091]
    404776 (BLEC1)
Pattern recognition receptors [BR:gga04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   404776 (BLEC1)
Lectins [BR:gga04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   404776 (BLEC1)
SSDB
Motif
Pfam: Lectin_C UL45
Other DBs
NCBI-GeneID: 404776
NCBI-ProteinID: NP_998747
CGNC: 49882
Ensembl: ENSGALG00000028659
UniProt: Q6ZYP6
Position
16
AA seq 188 aa
MEEVREYPHVLGTEWSRREGPSRGACVTFQLTMAAVFTVLLITAVAFAVQAFQPHPQPCA
QCPFDWIGFRGKCYYFSEDESNWTSSQNNCSALGASLAVFDSAEDLSFTMRHKGSSPHWV
GLSREGKEHAWEWVNRSPLSHLFQVQGDGLCAYLGDAGLSSSHCSARRNWVCTKPALQKP
RKNFCIST
NT seq 567 nt   +upstreamnt  +downstreamnt
atggaggaagtgagggaatatccccatgttttgggcacagaatggagcaggagggaaggt
cccagccgtggggcgtgcgttaccttccagctcacgatggcagcggtgttcacagtgctg
ctcatcactgctgttgcctttgcagtgcaggcattccagccccatccccagccctgtgct
cagtgtcccttcgactggattggattcagaggaaaatgctactacttttcagaggatgag
agcaattggacgagcagccagaacaactgctctgcacttggtgcttccttggctgtgttt
gacagcgctgaggacttgagcttcacaatgagacacaaaggcagctccccccactgggtt
ggcctctcccgggaaggcaaagagcatgcatgggaatgggtgaaccgctctcctttgtct
cacctgttccaggtgcaaggcgatggtctctgtgcatacctgggggatgccgggctcagc
tcctcccactgcagcgcgcggaggaattgggtttgcaccaaacccgcgttgcaaaaaccg
aggaagaacttctgcatcagcacctga

DBGET integrated database retrieval system