KEGG   Gallus gallus (chicken): 404779Help
Entry
404779            CDS       T01006                                 

Gene name
NOCT
Definition
(RefSeq) nocturnin
  KO
K18764  nocturnin [EC:3.1.13.4]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     404779 (NOCT)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     404779 (NOCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Motif
Other DBs
NCBI-GeneID: 404779
NCBI-ProteinID: NP_001009928
CGNC: 7422
Ensembl: ENSGALG00000032957
UniProt: Q71H64
Position
4
AA seq 419 aa AA seqDB search
MYQGPARCLCSALPALRRAPAAASPPLRPRRPPALGPAAPRAAAGAASPRAACSMGNSTS
RLYSALAKTLSSSAVSQHQDCLEQPNSAQLEPIDPKDLLEECQLVLQKRPPRFQRTFVDL
KKNTASNHRPIRVMQWNILAQALGEGKDNFVQCPMEALKWEERKCLILEEILAYKPDILC
LQEVDHYFDTFEPLLSRLGYQCTFFPKPWSPCLDVEQNNGPDGCALFFLKERFELINSAN
IRLTAMKLKTNQVAIAQTLKCSETGRLFCIAVTHLKARTGWERFRSAQGCDLLQNLKSIT
QGAKIPLIICGDFNAEPTEEVYREFSNSSLNLNSAYKLLSPDGQSEPPYTTWKIRPSGEC
RHTLDYIWYSQHALNVNSALGLLTEEQIGPNRLPSFNYPSDHLSLVCDFSFNQDPDRLL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagggccccgcgcgctgcctctgctcggcgctgcccgccctccgccgcgcgccc
gccgccgcctcgccgcccctgcggccccgccgcccgccggccctcggtcccgccgccccg
cgggctgcagcgggggccgcgtcgccccgcgcagcttgttccatgggaaacagcaccagc
agactctacagcgcgctcgccaagacgctgagcagcagtgccgtgtcccagcaccaggac
tgcctggagcagcccaactcggcgcagctggagcccatagaccccaaggayctactggag
gaatgccagctcgttctgcagaaacggccacctcgcttccagaggaccttcgtggacctg
aagaaaaacacagccagtaaccaccgccccatccgggtcatgcagtggaacatcctcgcc
caagctctcggagaaggcaaagacaacttcgttcagtgccccatggaagctctgaagtgg
gaggaaaggaagtgcctcatcctggaggaaatccttgcctacaagccggatatcttgtgc
ctgcaagaagtcgaccactactttgacaccttcgagccactcctcagccgactgggctat
caatgtactttcttcccaaagccgtggtcgccgtgcctggatgtggagcagaacaacggg
ccggacggctgcgccttgtttttcctcaaagaacgcttcgagctcatcaacagcgcgaac
atccggctcaccgccatgaagctgaagaccaaccaagtagccatagctcagacactgaag
tgcagtgaaactggaagactgttctgcattgccgtcacccacctgaaagctcgtactggt
tgggagaggtttcggtctgcgcagggctgtgaccttctccagaacctgaagagcattact
cagggcgcaaagatccctctgatcatctgcggagacttcaatgcagagccgaccgaggag
gtctacagagaattctccaactccagcctcaacttaaacagcgcatacaagctgctgagc
cccgacgggcagtcagagcccccgtacaccacctggaagattcggccctcgggagagtgc
cggcatacactggattatatctggtattcccagcacgccttgaatgtgaactcagccctg
ggcttgctgactgaagagcaaattgggcccaacaggctgccctcattcaattacccttca
gatcacctgtctttggtgtgtgactttagttttaaccaagaccctgacagactgttataa

DBGET integrated database retrieval system