KEGG   Gallus gallus (chicken): 408038
Entry
408038            CDS       T01006                                 

Definition
(RefSeq) beta-keratin
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Keratin TIL
Other DBs
NCBI-GeneID: 408038
NCBI-ProteinID: NP_001001310
CGNC: 49892
Ensembl: ENSGALG00000024136
UniProt: R4GG12
Position
25
AA seq 124 aa
MSCYKEMISSRCLPPCEVTCPQPYADACSQPCVTSCGDSRAVVYPPPVVITFPGPILSSC
PQESIVGSSAPAGIGSSFGYESSLGYGSSQGSLGSYGYRSPYKYGRSFSSYGYGGYGAGS
CRPC
NT seq 375 nt   +upstreamnt  +downstreamnt
atgtcttgctacaaagagatgatcagctcccgctgcctgccaccctgcgaggtgacctgc
ccacagccctacgctgatgcctgcagccagccctgtgtcacctcctgtggggactccaga
gccgttgtctaccccccacctgtggtcatcaccttcccaggccccatcctcagctcctgc
cctcaggagagcatcgtgggcagctcagcaccagctggcattgggagctcgtttggatat
gagagctcacttggatacgggagctctcagggttctttgggctcctatggctacaggagc
ccatacaaatatgggaggtccttttcttcctatgggtacggtggttacggtgctgggagc
tgcagaccatgttaa

DBGET integrated database retrieval system