KEGG   Gallus gallus (chicken): 408039Help
Entry
408039            CDS       T01006                                 

Gene name
KRT14
Definition
(RefSeq) keratin, type I cytoskeletal 14
  KO
K07604  type I keratin, acidic
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    408039 (KRT14)
   04147 Exosome [BR:gga04147]
    408039 (KRT14)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     408039 (KRT14)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   408039 (KRT14)
  Exosomal proteins of other body fluids (saliva and urine)
   408039 (KRT14)
  Exosomal proteins of colorectal cancer cells
   408039 (KRT14)
  Exosomal proteins of melanoma cells
   408039 (KRT14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament DUF4407 Bacillus_HBL Keratin_2_head DUF5344 Atg14 TPR_MLP1_2 Jnk-SapK_ap_N
Motif
Other DBs
NCBI-GeneID: 408039
NCBI-ProteinID: NP_001001311
CGNC: 49893
Ensembl: ENSGALG00000003690
UniProt: Q6PVZ1 A0A1D5PZ89
Position
27
AA seq 467 aa AA seqDB search
MSTTVRQFSSSTSLKGLGGGSSRLSCGRAAGYRAPSVHGGSSSYSVSSRIVSGLGAGYGG
GYCSSVGGGLGGGFGASYGAGYGAGFGGGFGAGFGGGFGGGDGILPAGEKETMQNLNDRL
AAYLDKVRALEEANTDLEVKIREWYKKQGPGPERDYSPYYRTIEELRSKILAATVENANI
VLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLSRADLEMQIENLKEEL
AYLKKNHEEEMNALRGQVGGEISVEMDAAPGIDLTKILAEMREQYESLAEKNRRDAEQWF
FSKTEELNREVAVNTEQLQSGKTEITELRRTIQSLEIDLQSQLSTKAALEGTLADTEARY
GTQLAQLQALITSVEEQLAELRCDMERQNHEYRVLLDVKCRLEQEIATYRRLLEGEDAHI
SSQYSSAMSSHSGRDAITTSRQVRTIVEEVQDGKVVSSREQMALTTR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccactgtccggcagttctcctcctccacctccctcaagggactgggggggggc
tccagcaggctgtcctgtggccgggcagcgggctaccgggcccccagtgtccatgggggc
tccagcagctactccgtctcctcccgcatcgtctcggggctcggcgccggctatgggggc
ggctactgcagcagtgtcggagggggcctcggcgggggcttcggggccagctatggggcc
ggctatggggctggcttcgggggcggctttggggccggcttcgggggcggcttcgggggc
ggcgatggcatcctcccggccggcgagaaggaaacaatgcagaacctcaacgaccgcctg
gccgcctacctggacaaggtgcgcgccctggaggaggccaacactgatctggaggtgaag
atcagggagtggtacaagaagcaggggcccggccctgagcgcgactacagcccctactac
cggaccatcgaggagctgcgcagcaagattcttgccgcaactgttgagaatgccaacatt
gtcctgcagattgacaatgccaggctggcagctgatgacttcagaaccaagtttgagacg
gagcaggccctgcgtctgagcgtggaggccgacatcaacgggctgcgcagggtgctggat
gagctgaccctgtccagggctgacctggagatgcagattgagaacctgaaggaggagcta
gcctacctgaagaagaaccacgaggaggaaatgaacgcgctgcgcggacaggtgggagga
gagatcagcgtggagatggacgcggctcccggcattgacctcaccaagatcctggctgag
atgcgggagcagtacgagagcctggcggagaagaaccggcgggatgctgagcagtggttc
ttcagcaagacggaggagctgaaccgcgaggtggccgtcaacacggagcagctgcagagc
ggcaagacggagatcacggagctgcgccgcaccatccagagcctggagatcgacctgcag
tcccagctcagcacgaaagcggcgctggagggcaccctggccgacaccgaggcgcgctac
ggcacccagctggcccagctgcaggcgctgatcaccagcgtggaggagcagctggccgag
ctgcgctgtgacatggagcggcagaaccacgagtaccgcgtgctgctggacgtcaagtgc
cgcctggagcaggagatcgccacgtaccgccggctgctggagggcgaggacgcccacatc
tcttcccagtactcctctgcaatgtcctcacactctggcagagacgccattacgacctcg
cgccaggtgcgcaccatcgtggaggaggtgcaggacgggaaggtggtctcatcccgtgag
cagatggcgctcaccacacgctag

DBGET integrated database retrieval system