KEGG   Gallus gallus (chicken): 408040
Entry
408040            CDS       T01006                                 

Gene name
KRT15
Definition
(RefSeq) keratin, type I cytoskeletal 15
  KO
K07604  type I keratin, acidic
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    408040 (KRT15)
   04147 Exosome [BR:gga04147]
    408040 (KRT15)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     408040 (KRT15)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   408040 (KRT15)
  Exosomal proteins of other body fluids (saliva and urine)
   408040 (KRT15)
  Exosomal proteins of colorectal cancer cells
   408040 (KRT15)
  Exosomal proteins of melanoma cells
   408040 (KRT15)
SSDB
Motif
Pfam: Filament Atg14 DUF4407 TPR_MLP1_2 APG6_N PI3K_P85_iSH2 Spc7 Baculo_PEP_C
Other DBs
NCBI-GeneID: 408040
NCBI-ProteinID: NP_001001312
CGNC: 49894
Ensembl: ENSGALG00000019718
Position
27
AA seq 464 aa
MTTYTVQNSFASGAGGLGAAGSGSSRLSSVRVGGSYRTPSIHGGSGGRGVSISSTKYVSS
VGGGYGGGSCAGFGGGYGGGYGGFGGGAVCGLGGGAGFGGGFDAICAFGGGDGLLSGNEK
ITMQNLNDRLATYLQKVRALEDANAELEVKIRDWYQKEAPSSPARDYSNYYKIIEDLQDK
ILAATIDNSRVVLEIDNARLAADDFRLKHENELFLRQSVESDINGLRRVLDELTLSRADL
EMQIESLKEELAYLKKNHEEEMKEYSNQLSGKVSVEMDAAPGIDLTRILSEMREQYEALA
EKYRKDAEAWFLTQTTELNHEVATHTEQIQSSKSEITELRRTMQSLEIELQSQISMKAGL
EANLRDTEGRYCAQLAQIQNLITSVEEQLSEIRCDMERQNQEYRMLMDIKSRLEQEIATY
RQLLETQDSQMSGVNPKDASAAGRARGGTEDEGRSSSTRDRRHQ
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgactacttacaccgtgcagaactcctttgctagtggtgctgggggccttggggctgct
ggcagcggcagctcccgcctttcctctgtgcgggtcgggggctcctaccgcaccccgagc
atccacggggggtccgggggtcggggcgtctccatctcctcgacgaagtacgtctcctcc
gtgggaggcggttacggtggtggatcctgcgccgggtttggcggcggttacggaggaggc
tatggcggctttggtggaggtgcagtctgcggcttgggtggaggagctggctttggtgga
ggctttgatgctatctgtgcctttggtggaggtgacggccttctttctggcaacgagaag
ataacgatgcagaatctgaacgaccgcctggccacgtacctgcagaaggtgcgagccttg
gaagatgcaaatgcagaattagaagtcaaaatccgagactggtaccagaaggaagctccc
agcagcccagctcgagactacagcaactactacaagataattgaagatctccaagataag
atccttgcagctactatcgacaactccagggtcgttctggagattgacaacgccaggctg
gctgcagatgacttcagactgaagcatgagaatgagcttttcctgcgccagagcgtggag
tctgacatcaacgggctgcgcagggtgctggatgagctgaccctgtccagggccgacctg
gagatgcagatcgagagcctgaaggaggagctggcctacctgaagaagaaccacgaggag
gagatgaaggagtactccaatcagctcagcggaaaagtcagtgtggaaatggatgctgct
cctggcatcgatctgacaaggatcctctcggagatgagggagcagtacgaggctctggct
gagaagtaccgtaaggacgctgaggcatggttcctcacccagactactgagctgaaccat
gaagttgccacccacactgagcagatacagagcagcaaatcggagatcacagaactgaga
cgcacgatgcagagcctggagatcgagctgcagtcacagataagcatgaaagctggactg
gaagccaacctgcgagatacagaaggacgatactgcgcacagctggcacaaattcagaac
ctcatcaccagtgttgaggagcaactgagtgaaatcagatgcgacatggagcgccagaac
caggagtacagaatgctcatggacatcaaaagccgcctggagcaggagatcgccacgtac
cgccagctgctggagacccaggactctcagatgtcaggagtgaaccctaaggatgcaagt
gctgctggaagagcccgtgggggcacagaagatgagggaaggtcttcctccactcgtgac
aggagacaccaataa

DBGET integrated database retrieval system