KEGG   Gallus gallus (chicken): 408041Help
Entry
408041            CDS       T01006                                 

Gene name
KRT6A
Definition
(RefSeq) keratin 6A
  KO
K07605  type II keratin, basic
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    408041 (KRT6A)
   04147 Exosome [BR:gga04147]
    408041 (KRT6A)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     408041 (KRT6A)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   408041 (KRT6A)
  Exosomal proteins of other body fluids (saliva and urine)
   408041 (KRT6A)
  Exosomal proteins of colorectal cancer cells
   408041 (KRT6A)
  Exosomal proteins of bladder cancer cells
   408041 (KRT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip Spc7 Taxilin TPR_MLP1_2 Tropomyosin_1 DivIC Phage_GP20 TSNAXIP1_N DHR10 BRE1 Baculo_PEP_C SlyX ADIP LPP DUF1451 AAA_13 APG6_N Ribosomal_S30AE
Motif
Other DBs
NCBI-GeneID: 408041
NCBI-ProteinID: NP_001001313
CGNC: 49895
Ensembl: ENSGALG00000030629
UniProt: A0A1D5PXP0
Position
33
AA seq 522 aa AA seqDB search
MSRQSTVRIQRGRSGFSAASAIVPGTCRTSFSSRSVTRVGGCNAGSGFARVGGGFGSRSL
YSFGGCKRISAAGRGGGFYGTAGFGGGAGSMLGYGYGAFGGPGFPAGGIQEVSINQSLLK
PLNLEIDPSIQRIRKEEKEQIKTLNNKFASFIDKVRFLEQQNKVLETKWSLLQEQGMKTV
RNNLEPLFETYINNLRMQLNSLLSDKGRLEGELVNTQYLVEDFKKKYEDEINRRTIAENE
FVTLKKDVDASYMNKVELQAKADALTEEINFLRALYEAELSQMQTQISDTSVVLTMDNNR
NLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQATAGRHGDDLRSTKQEISELNR
HVQRLRAEIDSVKKQCANLKAAIADAEERGEIALKDAKAKLAELEDALQQAKADLARQLR
EYQELMNVKLALDIEIATYRKLLEGEECRLAGDGVPVNISVTRTTVGSGYGGGSNLSMGG
GMCSMGNNYSCSGPGGSSALGGGSSSSVKFFSSSSSRRSYRS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccagtccaccgtcaggatccagagggggagaagcggcttcagcgctgcgtcg
gccatcgtgcctggcacgtgccgcaccagcttcagctcacgctccgtcacccgtgttggg
ggctgcaatgctggcagcggctttgcaagggttggaggtggatttgggagcagaagcctc
tacagttttggtggatgcaagaggatctctgcagctggaaggggtggggggttctatggc
accgcagggtttggtggaggtgctgggagcatgctgggctatggatatggggcatttgga
ggccctgggttccctgctggtggcatccaggaggtctccattaatcagagccttctgaag
cccctcaacctggagatcgaccccagcatccagaggatccgaaaggaggagaaggagcag
atcaaaaccctcaacaacaaatttgcctccttcatcgacaaggtccgattcctcgagcaa
caaaacaaagtgctggaaacgaagtggagcctgctgcaggagcaggggatgaaaacggtc
cggaacaacctggagccactctttgagacgtacatcaacaacctgaggatgcagctgaac
agcctgctgagcgacaaggggaggctggagggagagcttgtcaacacacagtacttggtt
gaggacttcaagaagaagtacgaagatgaaatcaacaggcgtaccattgcagagaatgag
tttgtgacacttaagaaggatgtggatgcttcctacatgaacaaggttgaactacaagcc
aaggcagatgcattgaccgaagaaatcaatttcctgagagccctctacgaagccgagctg
tcccagatgcagacccagatctccgacacctccgtagtgctgaccatggacaacaaccgc
aacctggacctggacagcatcatcgccgaggtgaaggcgcagtatgaggacattgccaac
cgcagtcgggctgaagccgagtcctggtaccaaaccaagtatgaagagctgcaggctact
gcaggcaggcacggggatgacctccgcagcaccaagcaggagatctctgagctcaaccgg
cacgtccagcggctgcgggctgagattgatagcgtgaagaaacagtgtgcaaacctgaaa
gcagccatcgcggatgctgaggagcgcggggagatcgccctgaaggatgccaaagccaaa
ctggctgagctggaggatgccctgcagcaggcaaaggcagacctggcccggcagctgcgt
gagtaccaggagctgatgaacgtcaagctggccctggacattgagatcgcaacctacagg
aagctgctggagggcgaggagtgcaggctggctggagacggtgtcccagtgaatatctcc
gtgaccagaaccactgtgggatcgggatacggaggaggaagcaacctcagcatggggggt
ggcatgtgcagcatggggaacaactacagctgcagtgggcccgggggaagcagtgccttg
ggtgggggcagcagctccagcgtgaagttcttctcctcctcctcctcccggagaagttac
aggagctaa

DBGET integrated database retrieval system