KEGG   Gallus gallus (chicken): 408182
Entry
408182            CDS       T01006                                 

Gene name
CYB5R2
Definition
(RefSeq) NADH-cytochrome b5 reductase 2
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    408182 (CYB5R2)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     408182 (CYB5R2)
SSDB
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 408182
NCBI-ProteinID: NP_001258911
CGNC: 49905
Ensembl: ENSGALG00000032372
UniProt: Q5ZHX7 A0A1D5NTT2
Position
5
AA seq 304 aa
MEAFSGTPVVVAVAAVAATVLLLLLLRGAGRRPGRPVTLRDPQAKYPLPLVGKEEISHDT
KKFRFGLPSPDHVLGLPVGQHVYLSAKINGNLVIRAYTPVSSDETKGYVDLIIKVYYKNV
NPKFPEGGKMSQYLDSMKIGDVIDFRGPNGLLVYKGSGTFMIKPDKKSEAQRKFAKHLGM
IAGGTGITPMLQLIRHITSDPKDSTKCYLLFANQTEKDILLRAELEDIAKRHPDQVRLWY
TLDRPPQDWKYSSGFVTADMIKTHLPPPGSETLILMCGPPPMIQFACQPNLDKLGYPKSS
TFSY
NT seq 915 nt   +upstreamnt  +downstreamnt
atggaagcgttctcgggtacccccgtggtcgtcgccgtggccgcggtggccgcgacggtg
ctgctgctgctgctgctcagaggggcgggacggaggccgggccgcccggtcacgctgcgg
gacccgcaggccaaatacccgctgccgctggtgggcaaagaggagatcagccacgacacc
aagaaattccggtttgggctcccttcaccagatcatgtcttaggattacctgtaggccaa
cacgtttacctttctgcaaaaatcaatggtaatctggtgatccgagcctacaccccggtt
tccagtgatgagacaaaaggctatgttgatttaattataaaggtttactacaaaaatgtg
aatcccaagttcccagaaggtgggaagatgtcccagtaccttgacagcatgaagattgga
gatgttattgacttcagggggccaaacggactgcttgtctacaaggggtcaggtaccttt
atgatcaagcctgataagaagtctgaagcacagaggaagtttgcaaagcatcttgggatg
atagctggaggaacaggaataactcctatgttgcagctgatccgtcatatcacaagtgac
cctaaggactctacaaagtgttaccttctttttgctaatcagacagagaaggacatattg
ctcagagctgagctagaagacattgctaagaggcatcctgatcaggtcaggctctggtat
acgctggacaggcctccacaagattggaagtacagttctggtttcgtcactgcagacatg
attaaaacccacctccctccccctggcagtgagacgctcattcttatgtgtgggccacca
cctatgattcagtttgcctgtcagcccaacctggacaaactcggctatcccaagagcagt
acattttcctattaa

DBGET integrated database retrieval system