KEGG   Gallus gallus (chicken): 408183Help
Entry
408183            CDS       T01006                                 

Gene name
CYP26A1
Definition
(RefSeq) cytochrome P450 26A1
  KO
K07437  cytochrome P450 family 26 subfamily A
Organism
gga  Gallus gallus (chicken)
Pathway
gga00830  Retinol metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    408183 (CYP26A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:gga00199]
    408183 (CYP26A1)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP26 family
   408183 (CYP26A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 408183
NCBI-ProteinID: NP_001001129
CGNC: 5082
Ensembl: ENSGALG00000033695
UniProt: Q9PUB4
Position
6
AA seq 492 aa AA seqDB search
MGFSALVASALCTFLLPLLLFLAAVRLWDLYCASGRDPSCPLPLPPGTMGLPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGAENVRHILLGEHRLVSVQWPASVRTIL
GSGCLSNLHNGQHKHRKKVIMQAFSRDALQHYVPVIQEEVSACLAQWLGAGPCLLVYPEV
KRLMFRIAMRILLGFQPRQASPDGEQQLVEAFEEMIRNLFSLPIDVPFSGLYRGLRARNI
IHAKIEENIRAKMARKEPEGGYKDALQLLMEHTQGNGEQLNMQELKESATELLFGGHETT
ASAATSLIAFLGLHHDVLQKVRKELQLKGLLSGPNQEKQLNMEFLEQLKYTGCVIKETLR
LSPPVPGGFRIALKTLELNGYQIPKGWNVIYSICDTHDVADLFTDKDEFNPDRFMSPSPE
DSSRFSFIPFGGGLRSCVGKEFAKVLLKIFTVELARSCDWQLLNGPPTMKTGPIVYPVDN
LPAKFIGFSGQI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggcttctccgctctggtcgccagcgccctgtgcaccttcctgctgcccctgctgctc
ttcctggccgccgtccggctctgggacctgtactgcgccagcggccgcgaccccagctgt
ccgctgccgttgcccccgggcaccatggggctgcccttcttcggggagacgctgcagatg
gtgctgcagcggcggaaattcctgcagatgaagcgcaggaaatacggcttcatctacaag
actcacctctttgggcggcccactgtgcgggtgatgggcgctgagaatgtgcggcacatc
ctgctgggcgagcaccgcctggtctccgtgcagtggcccgcctcggtgcgcaccatcttg
ggctcgggctgcctctccaaccttcacaacgggcagcacaaacaccgcaaaaaggtgatc
atgcaggccttctcccgggatgccctgcagcactacgtgcctgtcatccaagaggaggtg
agtgcctgcctggcacagtggctgggtgccgggccctgcctgctggtgtatcccgaggtg
aagcgcctcatgttccgcatcgccatgcgcatcctgctgggcttccagccccgccaggcc
agccccgatggtgagcagcagctggtggaggccttcgaggagatgatccgcaacctcttc
tccctccccatcgatgtgcctttcagtgggctctaccggggcctgagggcgcgcaacatc
atccatgccaagattgaggagaacatccgtgccaagatggcccgcaaggagcccgagggt
ggctacaaggatgcactgcagctgttgatggagcacacacagggtaatggagagcagctc
aacatgcaggagctgaaggagtctgccacagagctgctctttggaggtcacgaaaccacg
gccagtgctgctacatcactgattgccttcctagggctccaccatgatgttctgcagaaa
gtgaggaaggagctgcaattaaaggggttactgtctggtcccaaccaagaaaaacaattg
aacatggagttcttggagcagctgaagtacacaggctgtgttatcaaggaaaccctcagg
ctgagccctcctgttcctggaggattccgaattgcactcaagacccttgagctgaatggt
taccagatccccaaaggctggaatgttatttacagtatctgcgatacccacgatgtggcc
gatctctttaccgacaaggacgagttcaacccggaccgcttcatgtctccgtctccggag
gactcctctaggttcagtttcattcctttcggtgggggcttgaggagctgcgtaggcaaa
gagtttgcaaaagtccttctaaaaatatttacggtggagctggcgcggagctgtgactgg
cagctgctaaatggacctcctacaatgaaaacgggccccatagtgtaccctgtggacaat
ctgcctgccaaattcataggtttcagcggccaaatctga

DBGET integrated database retrieval system