KEGG   Gallus gallus (chicken): 408251
Entry
408251            CDS       T01006                                 

Gene name
ADCYAP1
Definition
(RefSeq) glucagon family neuropeptides precursor
  KO
K05262  pituitary adenylate cyclase-activating polypeptide
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    408251 (ADCYAP1)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 408251
NCBI-ProteinID: NP_001001291
CGNC: 11024
Ensembl: ENSGALG00000014858
UniProt: Q58FG9
Position
2
AA seq 172 aa
MCSKALLALLVYGIIMHCSVYCSPAVGLQYPALRLEEEVYDEDGNTLQDFAYEQEPLGVA
GPPSALGEVYALYYPPGKRHADGIFSKAYRKLLGQLSARKYLHSLMAKRVGGASSGLGDE
AEPLSKRHIDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRVAYL
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtgtagcaaagcgctcttagccctcctggtctatggcataataatgcattgcagcgtc
tactgctcacccgccgttggactccagtacccggcgctcaggctggaggaggaggtgtac
gacgaggacgggaataccctgcaggacttcgcctacgagcaggagccgctgggggtggcg
gggccgccgtccgcgctgggcgaggtgtacgcgctgtactacccgccgggaaagaggcac
gccgatgggatcttcagcaaagcctacaggaaactcctgggccagctgtccgcaaggaaa
tacctgcactccctgatggccaagcgggtcggcggtgccagcagcggcctgggggacgag
gcggaaccgctcagcaagcggcacatagacggcatcttcacggacagctacagccgctac
cggaaacaaatggctgtcaagaaatacttagcggccgtcctggggaaaaggtataaacaa
agagttaaaaacaaaggacgccgagtagcgtatttgtag

DBGET integrated database retrieval system