KEGG   Gallus gallus (chicken): 414341
Entry
414341            CDS       T01006                                 

Gene name
AvBD10
Definition
(RefSeq) gallinacin-10 preproprotein
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Defensin_beta Defensin_propep
Other DBs
NCBI-GeneID: 414341
NCBI-ProteinID: NP_001001609
CGNC: 49915
Ensembl: ENSGALG00000016667
UniProt: Q6QLQ9
Position
3
AA seq 68 aa
MKILCLLFAVLLFLFQAAPGSADPLFPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLN
CCAKIPAQ
NT seq 207 nt   +upstreamnt  +downstreamnt
atgaagatcctctgcctgctcttcgctgttctcctcttcctcttccaggctgctccaggc
tcagcagacccacttttccctgacaccgtggcatgcaggactcaggggaatttctgccgt
gctggggcatgcccccccaccttcaccatctctgggcagtgccatggggggctgttaaac
tgctgtgccaagattccggcgcagtaa

DBGET integrated database retrieval system