KEGG   Gallus gallus (chicken): 414344Help
Entry
414344            CDS       T01006                                 

Gene name
TRH
Definition
(RefSeq) thyrotropin releasing hormone preproprotein
  KO
K05253  thyrotropin-releasing hormone
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    414344 (TRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRH Med2 Minor_capsid_2 DUF3460
Motif
Other DBs
NCBI-GeneID: 414344
NCBI-ProteinID: NP_001025554
CGNC: 6439
Ensembl: ENSGALG00000008490
UniProt: Q6ZXC3
Position
12
AA seq 260 aa AA seqDB search
MPSIQLPVLLLCLTLSGVCLNGRQFPPELSENMGRSSLDDILQRSGSHMLQSVLKKVEKK
EEMNKELNMPLPQWLSKRQHPGKRYISDPEKRQHPGKRDVEEKASFGDIQKRQHLGKTEV
EGYLVNYLELKKRQHPGRRSLWDQSTDISSSQLTYLNELSKRQHPGRRYLMYKHQHPSKR
GWNDELDLSDQNWEKHQQFGNRDRDSDSPDYTGPCDLQQSAICNKDSLLLDLAEKFSKEG
VEEKHQHPGRRSAWENETEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgccatctatccagctgccagtgctactcctttgcctgaccttgtctggtgtttgcctc
aacggcaggcagttccctccagaactaagtgaaaacatgggaagaagttccctggatgac
atcctgcagagatctgggagccacatgcttcaatctgtcctcaagaaagttgaaaagaaa
gaagagatgaataaagaattaaacatgcctctgccacaatggctttccaaaagacaacat
cctggaaaaagatacataagtgacccggagaagagacagcatcctggaaaaagagatgtt
gaggaaaaagcatcttttggagacattcagaagagacagcatttagggaaaacagaagta
gaaggctaccttgtcaactacctggagctgaaaaagcgacagcatcctggcagaaggtca
ctgtgggaccagtccactgacatctctagttcacagctaacttacttaaatgagttatcc
aaaagacagcatccaggcagaagatatctgatgtataaacaccagcatcctagcaagagg
ggctggaatgatgagctagacctaagtgatcaaaactgggagaaacatcagcagtttgga
aacagggacagggattctgacagcccagattatacaggtccctgtgaccttcagcagtct
gccatctgtaacaaagacagcttgttgcttgacttagcagaaaagtttagcaaagagggg
gtagaagaaaaacatcagcacccaggaaggaggtcagcatgggagaatgaaacagaggaa
tga

DBGET integrated database retrieval system