KEGG   Gallus gallus (chicken): 414845
Entry
414845            CDS       T01006                                 

Gene name
CDH3
Definition
(RefSeq) B-cadherin
  KO
K06796  cadherin 3, type 1, P-cadherin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414845 (CDH3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    414845 (CDH3)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Major cadherins
   414845 (CDH3)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_3 Big_9 Cadherin_4
Other DBs
NCBI-GeneID: 414845
NCBI-ProteinID: XP_003642004
CGNC: 20428
Position
11
AA seq 822 aa
MCGSRSGLCPLFLLLLLAAAPARPCSPPGPRRGSLPAPETFGGGAVLDDVEGPHVGVLPV
APRDASSPRVPVRSRRSLQEVPDVPRAHTALRRQKRDWVIPPIKVPENERGPFPKNLVQI
KSNRDREAKIFYSITGQGADAPPEGIFTIEKETGWMKVTQPLDREHINKYHLYSHAVSEN
GKPVEEPMEIIVTVTDQNDNKPQFTQEVFRGSVPEGALPGTSVMRVNATDADDDVETYNG
VIAYSILSQEPREPHPHMFTVNRATGTLSVIASGLDRERVREYTLTMQAADLDGQGLTTT
ALAVIEITDVNDNAPEFDPKTYEAAVPENEAELEVARLATTDLDEPHTPAWRAVYSIVRG
NEGGAFTITTDPASNEGVLRTAKGLDYEAKRQFVLHVAVVNEAPFAIKLPTATATVMVSV
EDVNEAPVFDPPLRLAQVPEDVPLGQPLASYTAQDPDRAQQQRIKYVMGSDPAGWLAVHP
ENGLITAREQLDRESPFTKNSTYVAVLLAVDDGLPPATGTGTLLLTLLDVNDHGPEPEPR
DIVICNRSPVPQVLTITDRDLPPNTGPFRAELSHGSGDSWAVEVGNGGDTVALWLTEPLE
QNLYSVYLRLFDRQGKDQVTVIRAQVCDCQGRVESCAQKPRVDTGVPIVLAVLGAVLALL
LVLLLLLLLVRRRKVVKEPLLLPEDDTRDNIFYYGEEGGGEEDQDYDLSQLHHGLDARPE
VIRNDVAPPLMAAPQYRPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGGGSE
ATSLSSLNSSASDQDQDYDYLNEWGNRFKKLAELYGGGEDEE
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtgcgggtcgcgctccgggctctgcccgctcttccttctcctgctgctcgccgccgcc
ccggctcggccgtgctcccccccggggccgcgccgcgggtcgctcccggcgccagagacc
tttggaggcggcgcggtgctggatgacgtcgaggggccccacgtcggggtgctgcccgtg
gctccccgggatgccagcagccctcgggtccccgtgcggagcagacgctccctgcaggag
gtccccgatgtcccccgcgctcacaccgctctgaggaggcagaagagggattgggtgatc
cctcccatcaaagttcccgagaatgagaggggtcccttccccaaaaacttggttcagatc
aaatccaaccgcgaccgggaggcaaagattttctacagcatcaccgggcagggggcggat
gctccccccgagggcatcttcaccattgagaaggagacaggctggatgaaggtgacgcag
ccgctggaccgggagcacatcaacaagtaccacctctactcccatgccgtgtccgaaaat
ggcaaacccgtggaggagccgatggagatcatagtgacggtgacggaccaaaatgacaac
aagccccagttcacacaggaggtgttccggggctccgtgcctgaaggcgcgctgccaggc
acttcggtgatgcgggtgaacgccacggatgctgatgatgatgtggagacctacaacggt
gtcatcgcctactccatcctcagccaggagccgcgggagccccatccccacatgttcacc
gtcaaccgcgccaccggcaccctcagcgtcatcgccagcggcctcgaccgggagcgcgtg
cgggagtacacgctgaccatgcaggcggctgacctggacgggcaggggctgaccacgacg
gcgctggctgtgattgagatcacggacgtcaatgacaacgcccctgagtttgaccccaaa
acgtatgaggcggctgtgccagagaatgaggccgagctggaggtggcccggttggccacc
acggacctggatgagccgcacacaccagcgtggcgtgccgtctactccatcgtgcgtggc
aatgagggcggtgccttcaccatcaccactgaccctgccagcaacgagggcgtcctgcgc
acggccaagggtctggactacgaggccaagcggcagttcgtgctccacgtggccgtggtc
aatgaagctcccttcgccatcaagctgcccacagccacggccacggtgatggtcagtgtg
gaggatgtgaatgaggcgcccgtcttcgacccgccgctgcggctggcccaggtgccggag
gacgtgccgctggggcagcccctcgcctcctatacagcacaggaccctgacagggcccag
cagcagcgcatcaagtacgtgatgggcagtgaccccgcgggctggctggccgtgcacccc
gagaacggcctcatcacagcacgggagcagctggaccgtgagtccccgttcaccaagaac
agcacctacgtggccgtgctgctggctgtggatgacggattgccacccgccacaggcacc
ggcacgctgctcctcaccctgctggatgtcaatgaccacggccctgagccggagccccgc
gacatcgtcatctgtaaccgcagccctgtgcctcaggtgctgaccatcaccgaccgggac
ctgccccccaacaccgggcccttccgtgccgagctgagccacggctctggggacagctgg
gcggtggaggttggcaatggaggtgacaccgttgccttgtggctgacggagcccctggag
cagaacctgtacagcgtctacctgcggctcttcgaccgccagggcaaggaccaggtcacc
gtcatcagggcacaggtgtgcgactgccagggccgcgtggagagctgtgcccagaagcca
cgcgtggatacgggtgtgcccatcgtgctggccgtgctgggtgctgtgctggccctgctg
ctcgtgctgctgctgctgcttctcctggtgaggaggaggaaggtggtgaaggagccgctg
ctgctgcctgaggacgacacaagggacaacatcttctactacggggaggaaggtgggggt
gaggaggaccaggactacgacctgagccagctgcaccacggcctggacgcccgccccgag
gtgatccgcaatgacgtggcccccccgctgatggccgccccccagtaccggccccggccc
gccaaccccgatgagatcgggaacttcatcgacgagaacctgaaggcagctgacacggac
cccacggcccccccctacgactcgctgctggtgttcgactacgagggcggcggctcggag
gccacctcgctcagctccctcaactcctccgcctccgaccaggaccaggactacgactac
ctcaacgagtggggcaaccgcttcaagaagctggcggagctctatggcggcggggaggat
gaagaatag

DBGET integrated database retrieval system