KEGG   Gallus gallus (chicken): 414849Help
Entry
414849            CDS       T01006                                 

Gene name
CDH13
Definition
(RefSeq) cadherin-13 precursor
  KO
K06808  cadherin 13, H-cadherin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    414849 (CDH13)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    414849 (CDH13)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    414849 (CDH13)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Major cadherins
   414849 (CDH13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_pro Cadherin_3 Cadherin_4 Big_9
Motif
Other DBs
NCBI-GeneID: 414849
NCBI-ProteinID: NP_001001760
CGNC: 4087
Ensembl: ENSGALG00000005483
UniProt: P33150
Structure
PDB: 

Position
11
AA seq 717 aa AA seqDB search
MQHKTQLTLSFLLSQVLLLACAEDLECTPGFQQKVFYIEQPFEFTEDQPILNLVFDDCKG
NNKLNFEVSNPDFKVEHDGSLVALKNVSEAGRALFVHARSEHAEDMAEILIVGADEKHDA
LKEIFKIEGNLGIPRQKRAILATPILIPENQRPPFPRSVGKVIRSEGTEGAKFRLSGKGV
DQDPKGIFRINEISGDVSVTRPLDREAIANYELEVEVTDLSGKIIDGPVRLDISVIDQND
NRPMFKEGPYVGHVMEGSPTGTTVMRMTAFDADDPSTDNALLRYNILKQTPTKPSPNMFY
IDPEKGDIVTVVSPVLLDRETMETPKYELVIEAKDMGGHDVGLTGTATATILIDDKNDHP
PEFTKKEFQATVKEGVTGVIVNLTVGDRDDPATGAWRAVYTIINGNPGQSFEIHTNPQTN
EGMLSVVKPLDYEISAFHTLLIKVENEDPLIPDIAYGPSSTATVQITVEDVNEGPVFHPN
PMTVTKQENIPIGSIVLTVNATDPDTLQHQTIRYSVYKDPASWLEINPTNGTVATTAVLD
RESPHVQDNKYTALFLAIDSGNPPATGTGTLHITLEDVNDNVPSLYPTLAKVCDDAKDLR
VVVLGASDKDLHPNTDPFKFELSKQSGPEKLWRINKLNNTHAQVVLLQNLKKANYNIPIS
VTDSGKPPLTNNTELKLQVCSCKKSRMDCSASDALHISMTLILLSLFSLFCKSFPYV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacaaaactcaacttactctgtcctttctgctgtcccaggttctgttgcttgcg
tgtgcagaagatttagaatgcacccctggattccagcaaaaggttttttatattgaacag
ccatttgaattcacagaggaccagccaattctgaacctggtgtttgatgactgcaagggg
aataacaaattgaacttcgaagtttctaacccagactttaaggtggaacacgatggatct
ttagttgcactgaagaatgtatcagaagctggcagagctttgtttgtccatgcacggtct
gagcatgctgaggatatggcagaaattttgattgttggagctgatgagaagcacgatgca
ttaaaggaaatctttaagatagaaggcaaccttggaattccaagacaaaaaagggctatt
ctggcgactccaatattaattccagaaaatcaaagaccaccatttcccagatcagttggc
aaggtcatcaggagtgaagggacagagggagcaaagttccgactctctggtaagggagta
gatcaagacccgaaaggaatttttagaatcaatgagatcagtggggatgtctctgtgacc
cgacccctggatagagaagcaatagccaattatgagctggaagttgaagtaacggattta
agtgggaaaatcattgatggcccagtccgcctagatatttctgttattgatcaaaatgat
aacaggccgatgttcaaagaaggaccctatgttggtcacgtcatggaaggatcccctaca
ggaacaactgtgatgcggatgacagcatttgatgctgatgatcctagcacagacaacgct
cttctgcggtataacatcctcaagcagacacctaccaaaccttccccaaatatgttctac
attgacccagaaaagggagatattgtcacagtggtgtcgcctgtactgctggatcgtgag
acaatggaaacgccgaagtacgagctggttattgaagccaaggatatgggcggccatgat
gtgggacttactggaactgcaactgccactattcttattgatgacaaaaacgaccaccca
ccagaatttaccaagaaggagtttcaggccacagtaaaggaaggagtcacaggagtaata
gtaaacttaactgttggtgaccgagatgacccagcaactggagcatggagagctgtctac
actattattaacggaaatccagggcagagttttgaaatccataccaatccccagactaat
gagggaatgctctctgttgtcaaacctttagactatgagatttcagcatttcacacattg
ctgataaaagtagaaaatgaagacccgttgattccagacatagcctacggtcccagttcc
acagcaacagttcagatcaccgttgaggatgtgaatgaaggccctgttttccacccaaac
ccaatgacagtgacaaaacaagagaacatccctattggcagcattgtgttaacagtaaat
gccactgatccagatactttgcaacatcagactatcaggtattcagtttacaaggatcca
gcaagctggctagagattaatcccaccaatggtaccgttgccaccactgctgtcctggat
cgggaatctccgcatgttcaggataacaaatacactgctctcttcctggcaatagacagt
ggtaaccctcctgctacaggtacaggaactttacacatcaccttggaggacgtcaatgac
aatgtcccctccctttacccaacactggcaaaagtctgtgatgatgctaaagatctcaga
gtagtggttctaggagcatcagacaaagacctccatcccaacacagatccatttaaattt
gaactgagtaagcaatctggtccagaaaagttatggagaatcaacaagcttaacaatact
catgcccaggttgtcctgcttcaaaacctgaaaaaggccaattacaacatcccaatctca
gtgacagattctggaaaaccacctctgactaacaacacagaactgaaattacaagtgtgt
tcctgcaagaaatccagaatggactgcagtgcaagtgatgcccttcatatcagcatgact
cttatccttctttcactcttcagtttattttgtaagtcttttccttatgtgtaa

DBGET integrated database retrieval system